DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and si:dkey-239j18.2

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001274132.1 Gene:si:dkey-239j18.2 / 321853 ZFINID:ZDB-GENE-121214-52 Length:335 Species:Danio rerio


Alignment Length:353 Identity:90/353 - (25%)
Similarity:154/353 - (43%) Gaps:41/353 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLCCLLLTIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYY--------FIYNRN--QV 59
            ::..||:|:.....|  ....:|.| .:|::|    |..:::..:|:        .|:..|  ::
Zfish     1 MMFALLVTLYISAVF--AAPSIDIQ-LDDHWN----SWKSQHGKSYHEDVEVGRRMIWEENLRKI 58

  Fly    60 AQHNAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAASDP----PASQAASASFDIIT 120
            .|||.:......|::..:|||.|:...:|...:....:.....:..|    |...||....| ..
Zfish    59 EQHNFEYSLGNHTFKMGMNQFGDMTNEEFRQAMNGYKHDPNRTSQGPLFMEPKFFAAPQQVD-WR 122

  Fly   121 DFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGM--GTGCSTQTP 183
            ..|....|:|| ..|.|.|::::..|:|.....:|...:  |:|.|.|:||:..  ..||:....
Zfish   123 QRGYVTPVKDQ-KQCGSCWSFSSTGALEGQLFRKTGKLI--SMSEQNLVDCSRPHGNQGCNGGLM 184

  Fly   184 LAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSN 248
            ..|..|:.:  :..|..|..||.......|....|..:|:   |:.|:..:...::.|:|..|:.
Zfish   185 DQAFQYVKE--NKGLDSEQSYPYLARDDLPCRYDPRFNVA---KITGFVDIPKGNELALMNAVAA 244

  Fly   249 GFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGYDH---DVDSNLDYWRCLNSFG 310
            ..||.|..:.:......|.||:|.:  ||.|: :....::||||.:   ||..| .||...||:.
Zfish   245 VGPVSVAIDASHQSLQFYQSGIYYE--RACTS-QLDHAVLVVGYGYQGADVAGN-RYWIVKNSWS 305

  Fly   311 DTWGEEGYIRIVRRSNQ--PIAKNAVFP 336
            |.||::|||.:.:..|.  .||..|.:|
Zfish   306 DKWGDKGYIYMAKDKNNHCGIATMASYP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 15/69 (22%)
Peptidase_C1A 114..336 CDD:239068 64/228 (28%)
si:dkey-239j18.2NP_001274132.1 Inhibitor_I29 28..86 CDD:214853 13/61 (21%)
Peptidase_C1 115..334 CDD:278538 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.