DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and ctsla

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_005165325.1 Gene:ctsla / 321453 ZFINID:ZDB-GENE-030131-106 Length:363 Species:Danio rerio


Alignment Length:297 Identity:76/297 - (25%)
Similarity:125/297 - (42%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALL-----PKAVNTVTSAASDPPASQAASA 114
            |..::..||.:......|||..:|.|.|:...:|..::     .|......|...:|...:..:.
Zfish    81 NLKKIEMHNLEHSMGIHTYRLGMNHFGDMTHEE
FRQVMNGFKHKKDRRFRGSLFMEPNFIEVPNK 145

  Fly   115 SFDIITDF---GLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGM-- 174
                 .|:   |....|:||| .|.|.||::|..|:|.....:|...:  |||.|.|:||:..  
Zfish   146 -----LDWREKGYVTPVKDQG-ECGSCWAFSTTGALEGQMFRKTGKLV--SLSEQNLVDCSRPEG 202

  Fly   175 GTGCSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDD 239
            ..||:......|..|:.....  |..|..||...:...|....|.:|.:   ...|:..:....:
Zfish   203 NEGCNGGLMDQAFQYVKDQNG--LDSEESYPYLGTDDQPCHFDPKNSAA---NDTGFVDIPSGKE 262

  Fly   240 AAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGY---DHDVDSNLD 301
            .|:|:.::...||.|..:.....|..|.||:|.:  :..::.:....::.|||   ..|||.. .
Zfish   263 RALMKAIAAVGPVSVAIDAGHESFQFYQSGIYYE--KECSSEELDHGVLAVGYGFEGEDVDGK-K 324

  Fly   302 YWRCLNSFGDTWGEEGYIRIV--RRSNQPIAKNAVFP 336
            ||...||:.:.||::|||.:.  |.::..||..|.:|
Zfish   325 YWIVKNSWSENWGDKGYIYMAKDRHNHCGIATAASYP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 9/32 (28%)
Peptidase_C1A 114..336 CDD:239068 62/231 (27%)
ctslaXP_005165325.1 Inhibitor_I29 55..113 CDD:214853 9/31 (29%)
Peptidase_C1 142..362 CDD:278538 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.