DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsw

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001019413.1 Gene:Ctsw / 293676 RGDID:1309354 Length:371 Species:Rattus norvegicus


Alignment Length:351 Identity:89/351 - (25%)
Similarity:148/351 - (42%) Gaps:63/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLTIDSGWAFNHGQDLVD-FQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHN-AQADR---- 68
            |||.|:|   ....:|.: |:.::..||::|:     |.|.|   ..|..:..|| |||.|    
  Rat    24 LLTKDAG---PRPLELKEVFKLFQIQFNRSYS-----NPAEY---TRRLGIFAHNLAQAQRLQEE 77

  Fly    69 NRTTYREAVNQFSDIRLIQFAAL------------LPKAVNTVTSAASDPPASQAASASFDIITD 121
            :..|.......|||:...:|..|            :.|.|.:.....|.||........ :||: 
  Rat    78 DLGTAEFGQTPFSDLTEEEFGQLYGHQRAPERILNMAKKVKSERWGESVPPTCDWRKVK-NIIS- 140

  Fly   122 FGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTPLAA 186
                 ::::|| ||...||.|.|..::.:..::|...:  .:|.|:||||...|.||:......|
  Rat   141 -----SIKNQG-NCRCCWAIAAADNIQTLWRIKTQQFV--DVSVQELLDCDRCGNGCNGGFVWDA 197

  Fly   187 LNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFP 251
              |:|.|.::.|..|.|||.....| |..|.......| ..:..::.::.|:. .:..|::...|
  Rat   198 --YITVLNNSGLASEEDYPFQGHQK-PHRCLADKYRKV-AWIQDFTMLSSNEQ-VIAGYLAIHGP 257

  Fly   252 VIVEYNPATFGFMQYSSGVYVQETRALTNPK-SSQFLVVVGYDHDVDS---------------NL 300
            :.|..|.....:  |..|| ::.|.:..:|. .:..:::||:..:...               :.
  Rat   258 ITVTINMKLLQY--YQKGV-IKATPSTCDPHLVNHSVLLVGFGKEKGGMQTGTLLSHSRKPRRST 319

  Fly   301 DYWRCLNSFGDTWGEEGYIRIVRRSN 326
            .||...||:|..|||:||.|:.|.:|
  Rat   320 PYWILKNSWGAEWGEKGYFRLYRGNN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 18/64 (28%)
Peptidase_C1A 114..336 CDD:239068 58/229 (25%)
CtswNP_001019413.1 Inhibitor_I29 40..96 CDD:214853 18/63 (29%)
Peptidase_C1 126..356 CDD:278538 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.