DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsr

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_783171.2 Gene:Ctsr / 290975 RGDID:631422 Length:334 Species:Rattus norvegicus


Alignment Length:360 Identity:90/360 - (25%)
Similarity:154/360 - (42%) Gaps:56/360 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKLLLCCLLLTIDSG-WAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHNAQ 65
            |..:||   |.:.|| .||:...| .::..::..:.|:| :..........:..|...:..||.:
  Rat     6 FLAILC---LGVGSGALAFDPSLD-AEWHDWKTEYEKSY-TMEEEGHRRAVWEENMKMIKLHNRE 65

  Fly    66 ADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAASDPPASQAASASF------DIITDF-- 122
            ....:..:...:|:|.|:...:|..::   ||.       |..|.......      :::..|  
  Rat    66 NSLGKNGFIMEMNEFGDLTAEEFRKMM---VNI-------PIRSHRKGKIIRKRDVGNVLPKFVD 120

  Fly   123 ----GLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCA-GMGT-GCSTQ 181
                |....|::|.. |:|.||:|...|:|.....:|....|  ||.|.|:||. ..|. ||...
  Rat   121 WRKKGYVTRVQNQKF-CNSCWAFAVTGAIEGQMFNKTGQLTP--LSVQNLVDCTKSQGNEGCQWG 182

  Fly   182 TPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQ--PPSSVSVGVKLAGYSTVADNDDAAVMR 244
            .|..|..|:  |.:..|..|..||....   .|:|:  |..|.:   ::.|:.::.:::| .:|.
  Rat   183 DPHIAYEYV--LNNGGLEAEATYPYKGK---EGVCRYNPKHSKA---EITGFVSLPESED-ILME 238

  Fly   245 YVSNGFPVIVEYNPA--TFGFMQYSSGVYVQETRALTNPKSSQFLVVVGY---DHDVDSNLDYWR 304
            .|:...|:.|..:.:  :|||  |..|:|.:..  .:|...:..::||||   .::.|.| .||.
  Rat   239 AVATIGPISVAVDASFNSFGF--YKKGLYDEPN--CSNNTVNHSVLVVGYGFEGNETDGN-SYWL 298

  Fly   305 CLNSFGDTWGEEGYIRIVRRSNQ--PIAKNAVFPS 337
            ..||:|..||..||::|.:..|.  .||..|.:|:
  Rat   299 IKNSWGRKWGLRGYMKIPKDQNNFCAIASYAHYPT 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 8/59 (14%)
Peptidase_C1A 114..336 CDD:239068 67/244 (27%)
CtsrNP_783171.2 PTZ00203 7..332 CDD:185513 88/356 (25%)
Inhibitor_I29 29..87 CDD:214853 8/58 (14%)
Peptidase_C1A 116..332 CDD:239068 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.