DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Testin

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_775155.1 Gene:Testin / 286916 RGDID:708447 Length:333 Species:Rattus norvegicus


Alignment Length:385 Identity:84/385 - (21%)
Similarity:137/385 - (35%) Gaps:110/385 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLCCLLLTIDS--------------GWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIY 54
            |.|..|.|.:||              .|...||      :||..|..:...:...:||       
  Rat     5 LFLAILCLEVDSTAPTPDPSLDVEWNEWRTKHG------KTYNMNEERLKRAVWEKNF------- 56

  Fly    55 NRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALL----------------------PKAVN 97
              ..:..||.:....|..:..|:|.|.|:..|:|..::                      ||.|:
  Rat    57 --KMIELHNWEYLEGRHDFTMAMNAFGDLTNIEFVKMMTGFQRQKIKKTHIFQDHQFLYVPKRVD 119

  Fly    98 TVTSAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSS 162
            .                     ...|....|::|| :|:||||::...::|.....:|...:|  
  Rat   120 W---------------------RQLGYVTPVKNQG-HCASSWAFSATGSLEGQMFRKTERLIP-- 160

  Fly   163 LSAQQLLDCAGMGT--GCSTQTPLAALNYLTQLTDAYLYPEVDYP------------NNNSLKTP 213
            ||.|.||||.|...  |||......|..|:..  :..|..|..||            .|::....
  Rat   161 LSEQNLLDCMGSNVTHGCSGGFMQYAFQYVKD--NGGLATEESYPYRGQGRECRYHAENSAANVR 223

  Fly   214 GMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQETRAL 278
            ...|.|.|                 :.|:|:.|:...|:.|..:.:...|..|.||:|.:.....
  Rat   224 DFVQIPGS-----------------EEALMKAVAKVGPISVAVDASHGSFQFYGSGIYYEPQCKR 271

  Fly   279 TNPKSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRR-SNQ-PIAKNAVFP 336
            .:...:..:|..|::.:......:|...||:|:.||.:||:::.:. ||. .||..:.:|
  Rat   272 VHLNHAVLVVGYGFEGEESDGNSFWLVKNSWGEEWGMKGYMKLAKDWSNHCGIATYSTYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 13/59 (22%)
Peptidase_C1A 114..336 CDD:239068 57/237 (24%)
TestinNP_775155.1 Inhibitor_I29 29..87 CDD:214853 15/72 (21%)
Peptidase_C1 114..332 CDD:395062 61/261 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.