DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsh

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_037071.1 Gene:Ctsh / 25425 RGDID:2447 Length:333 Species:Rattus norvegicus


Alignment Length:370 Identity:101/370 - (27%)
Similarity:151/370 - (40%) Gaps:85/370 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLCCLLLTIDSGWAFNHGQ---------DLVDFQTYEDNFNKTYASTSARNFAN--YYFIYNRNQ 58
            |||.      ..|..:.|.         :...|.::.....|||   |:|.:::  ..|..|..:
  Rat     7 LLCA------GAWLLSAGATAELTVNAIEKFHFTSWMKQHQKTY---SSREYSHRLQVFANNWRK 62

  Fly    59 VAQHNAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAASDPPASQAAS---------- 113
            :..||   .||. |::..:|||||   :.||.:..|.:      .|:|....|..          
  Rat    63 IQAHN---QRNH-TFKMGLNQFSD---MSFAEIKHKYL------WSEPQNCSATKSNYLRGTGPY 114

  Fly   114 -ASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAG--MG 175
             :|.|......:...|::||. |.|.|.::|..|:|  :||..|:....:|:.|||:|||.  ..
  Rat   115 PSSMDWRKKGNVVSPVKNQGA-CGSCWTFSTTGALE--SAVAIASGKMMTLAEQQLVDCAQNFNN 176

  Fly   176 TGCSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQ--PPSSVS-----VGVKLAGYST 233
            .||....|..|..|:  |.:..:..|..||   .:...|.|:  |..:|:     |.:.|     
  Rat   177 HGCQGGLPSQAFEYI--LYNKGIMGEDSYP---YIGKNGQCKFNPEKAVAFVKNVVNITL----- 231

  Fly   234 VADNDDAAVMRYVSNGFPVIVEYNPATFG------FMQYSSGVYVQETRALTNPKSSQFLVVVGY 292
               ||:||::.       .:..|||.:|.      ||.|.||||...:...|..|.:..::.|||
  Rat   232 ---NDEAAMVE-------AVALYNPVSFAFEVTEDFMMYKSGVYSSNSCHKTPDKVNHAVLAVGY 286

  Fly   293 DHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQ-PIAKNAVFP 336
            ..  .:.|.||...||:|..||..||..|.|..|. .:|..|.:|
  Rat   287 GE--QNGLLYWIVKNSWGSNWGNNGYFLIERGKNMCGLAACASYP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 18/61 (30%)
Peptidase_C1A 114..336 CDD:239068 71/237 (30%)
CtshNP_037071.1 Inhibitor_I29 33..88 CDD:400519 20/64 (31%)
Peptidase_C1 115..330 CDD:395062 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.