DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsq

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_640355.1 Gene:Ctsq / 246147 RGDID:631421 Length:343 Species:Rattus norvegicus


Alignment Length:377 Identity:96/377 - (25%)
Similarity:153/377 - (40%) Gaps:79/377 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLLLC--------CLLLTIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIYNRN 57
            :|.::||        .|.|::|..|           |.::..:.|.| |..........:..|..
  Rat     5 VFLVILCLGVVPGASALDLSLDVQW-----------QEWKIKYEKLY-SPEEEVLKRVVWEENVK 57

  Fly    58 QVAQHNAQADRNRTTYREAVNQFSDIRLIQFAAL-----LPKAVNTVTSAASDPPASQAASASF- 116
            ::..||.:....:.||...:|.|:|:...:|..:     || ..||      :....:.|..|| 
  Rat    58 KIELHNRENSLGKNTYTMEINDFADMTDEEFKDMIIGFQLP-VHNT------EKRLWKRALGSFF 115

  Fly   117 -------DIITDF------GLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQL 168
                   |.:..|      |....|..|| .|||.||:....|:|.....:|...:|  ||.|.|
  Rat   116 PNSWNWRDALPKFVDWRNEGYVTRVRKQG-GCSSCWAFPVTGAIEGQMFKKTGKLIP--LSVQNL 177

  Fly   169 LDCAGM--GTGCSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQ--PPSSVSVGVKLA 229
            :||:..  ..||.......|..|:  |.:..|..|..||..   :..|:|:  |.:|   ..|:.
  Rat   178 IDCSKPQGNRGCLWGNTYNAFQYV--LHNGGLEAEATYPYE---RKEGVCRYNPKNS---SAKIT 234

  Fly   230 GYSTVADNDDAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQF----LVVV 290
            |:..:.:::| .:|..|:...|:....:..:..|..|..|||.:       ||.|.:    ::||
  Rat   235 GFVVLPESED-VLMDAVATKGPIATGVHVISSSFRFYQKGVYHE-------PKCSSYVNHAVLVV 291

  Fly   291 GY---DHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQ--PIAKNAVFPS 337
            ||   .::.|.| :||...||:|..||..||::|.:..|.  .||..|.:|:
  Rat   292 GYGFEGNETDGN-NYWLIKNSWGKRWGLRGYMKIAKDRNNHCAIASLAQYPT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 12/59 (20%)
Peptidase_C1A 114..336 CDD:239068 70/248 (28%)
CtsqNP_640355.1 PTZ00203 4..341 CDD:185513 95/374 (25%)
Inhibitor_I29 29..87 CDD:214853 13/69 (19%)
Peptidase_C1 125..342 CDD:278538 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.