DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Y71H2AM.3

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_497622.2 Gene:Y71H2AM.3 / 190606 WormBaseID:WBGene00022168 Length:483 Species:Caenorhabditis elegans


Alignment Length:173 Identity:35/173 - (20%)
Similarity:54/173 - (31%) Gaps:63/173 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RTTYREAVNQFSDIRLIQFAA-LLPKA--------------VNTVTSAASDPPASQAASASFDII 119
            :|.:|.||:.....:|.:||| ..||.              :.|:.....|...:...||.|   
 Worm   176 KTAHRLAVDVCKIEKLEEFAAKAFPKIICARCKQLILSEEYIMTIQCLPDDDFLATTQSADF--- 237

  Fly   120 TDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANP--LP-----------SSLSAQQLLD- 170
                  ...:..|.:|... .:...|..|:     .|||  ||           |.:..|.::| 
 Worm   238 ------FCRDSCGASCDPD-RHKNVKREEL-----KANPKWLPNEKKVMISYANSIIHKQSVIDG 290

  Fly   171 -----------CAGMGTGCSTQTPLAALNYLTQLTDAYLYPEV 202
                       ||    ||..|......|:    .|.|.:.::
 Worm   291 TLIIDDKANIKCA----GCKCQLGKIQKNH----PDIYCFNQI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 5/17 (29%)
Peptidase_C1A 114..336 CDD:239068 22/114 (19%)
Y71H2AM.3NP_497622.2 HECT_2 <201..467 CDD:303071 26/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.