DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and C32B5.7

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001293573.1 Gene:C32B5.7 / 183111 WormBaseID:WBGene00016300 Length:234 Species:Caenorhabditis elegans


Alignment Length:280 Identity:73/280 - (26%)
Similarity:109/280 - (38%) Gaps:78/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RNFANYYFIYNRNQVAQH--NAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAASDPP 107
            ||..||..::....:..:  .|...:....|:.|...|.|.|                       
 Worm    18 RNTRNYIGLFLLTALTFYIIGALVQQRTQNYKNAKKPFLDWR----------------------- 59

  Fly   108 ASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCA 172
                         |.|:...|:||| ||::|:|:|...|:|.|.|:  ||....|.|.||::||.
 Worm    60 -------------DEGVVGPVKDQG-NCNASYAFAAISAIESMYAI--ANGQLLSFSEQQIIDCL 108

  Fly   173 GMGTGCSTQT-PLAALNYLTQ-----LTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGY 231
            |   ||:.:: |:.|:.||.:     .||   ||.|...|..       |:..|.       ..|
 Worm   109 G---GCAIESDPMMAMTYLERKGIETYTD---YPFVGKKNEK-------CEYDSK-------KAY 153

  Fly   232 STVAD----NDDAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVY--VQETRALTNPKSSQFLVVV 290
            ..:.|    :|::..:.::....|.:...|... .|..|.||:|  .:|....||.|.:  |.:|
 Worm   154 LILDDTYDMSDESLALVFIDERGPGLFTMNTPP-SFFNYKSGIYNPTEEECKSTNEKRA--LTIV 215

  Fly   291 GYDHDVDSNLDYWRCLNSFG 310
            ||.:|...|  ||....|||
 Worm   216 GYGNDKGQN--YWIVKGSFG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 10/44 (23%)
Peptidase_C1A 114..336 CDD:239068 63/209 (30%)
C32B5.7NP_001293573.1 Peptidase_C1A 56..234 CDD:239068 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.