DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and CTSW

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:381 Identity:90/381 - (23%)
Similarity:141/381 - (37%) Gaps:101/381 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLLLTIDSGWAFN-----HGQDL--------VDFQTYEDNFNKTYASTSARNFANYYFIYNRNQV 59
            |||..:.:|.|..     ..|||        ..|:.::..||::|.|....        .:|..:
Human     9 CLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEH--------AHRLDI 65

  Fly    60 AQHN-AQADR----NRTTYREAVNQFSDIRLIQFAAL--LPKAVNTVTS-----AASDPPASQAA 112
            ..|| |||.|    :..|....|..|||:...:|..|  ..:|...|.|     .:.:|..|...
Human    66 FAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPF 130

  Fly   113 SASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGMGTG 177
            |..:..:.  .....::|| .||:..||.|.|..:|.:..:...:.:  .:|.|:||||...|.|
Human   131 SCDWRKVA--SAISPIKDQ-KNCNCCWAMAAAGNIETLWRISFWDFV--DVSVQELLDCGRCGDG 190

  Fly   178 CSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVA------- 235
            |.......|  ::|.|.::.|..|.|||....::. ..|.|..          |..||       
Human   191 CHGGFVWDA--FITVLNNSGLASEKDYPFQGKVRA-HRCHPKK----------YQKVAWIQDFIM 242

  Fly   236 -DNDDAAVMRYVSNGFPVIVEYN---------------PAT--------------FGFMQYSSGV 270
             .|::..:.:|::...|:.|..|               |.|              ||.::...|:
Human   243 LQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGI 307

  Fly   271 YVQETRALTNPKSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSN 326
            :.:...:.:.|:.         .|..    .||...||:|..|||:||.|:.|.||
Human   308 WAETVSSQSQPQP---------PHPT----PYWILKNSWGAQWGEKGYFRLHRGSN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 17/64 (27%)
Peptidase_C1A 114..336 CDD:239068 57/250 (23%)
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 17/63 (27%)
Peptidase_C1A 129..358 CDD:239068 58/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.