DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and CTSS

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_004070.3 Gene:CTSS / 1520 HGNCID:2545 Length:331 Species:Homo sapiens


Alignment Length:351 Identity:88/351 - (25%)
Similarity:139/351 - (39%) Gaps:46/351 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCCLLLTIDSGWAFNHGQDLVD--FQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHNAQADR 68
            |.|:||...|..|..|....:|  :..::..:.|.|...:........:..|...|..||.:...
Human     4 LVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSM 68

  Fly    69 NRTTYREAVNQFSDIRLIQFAALL-----PKAVNTVTSAASDPPASQAASASFDIITDFGLTVAV 128
            ...:|...:|...|:...:..:|:     |.......:..|:|......|..:   .:.|....|
Human    69 GMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDW---REKGCVTEV 130

  Fly   129 EDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGM---GTGCSTQTPLAALNYL 190
            :.|| :|.:.||::...|:|....::|...:  |||||.|:||:..   ..||:......|..|:
Human   131 KYQG-SCGACWAFSAVGALEAQLKLKTGKLV--SLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYI 192

  Fly   191 TQL----TDA-YLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGF 250
            ...    :|| |.|..:|.          .||..|...... .:.|:.:....:..:...|:|..
Human   193 IDNKGIDSDASYPYKAMDQ----------KCQYDSKYRAAT-CSKYTELPYGREDVLKEAVANKG 246

  Fly   251 PVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQ----FLVVVGYDHDVDSNLDYWRCLNSFGD 311
            ||.|..:.....|..|.||||.:       |..:|    .::||||. |::.. :||...||:|.
Human   247 PVSVGVDARHPSFFLYRSGVYYE-------PSCTQNVNHGVLVVGYG-DLNGK-EYWLVKNSWGH 302

  Fly   312 TWGEEGYIRIVRRSNQPIAKNAVFPS 337
            .:|||||||:.|....... .|.|||
Human   303 NFGEEGYIRMARNKGNHCG-IASFPS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 9/59 (15%)
Peptidase_C1A 114..336 CDD:239068 63/233 (27%)
CTSSNP_004070.3 PTZ00203 5..326 CDD:185513 84/347 (24%)
Inhibitor_I29 28..87 CDD:214853 9/58 (16%)
Peptidase_C1 115..329 CDD:278538 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.