DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and CTSO

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001325.1 Gene:CTSO / 1519 HGNCID:2542 Length:321 Species:Homo sapiens


Alignment Length:312 Identity:76/312 - (24%)
Similarity:134/312 - (42%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FNKTYASTSARNFANYYFIYNRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTV 99
            |..|:..:..|..|.:....||::.......::.:...|  .:||||.:...:|     ||:...
Human    29 FTPTWPRSREREAAAFRESLNRHRYLNSLFPSENSTAFY--GINQFSYLFPEEF-----KAIYLR 86

  Fly   100 TSAASDPPASQAASASFDIIT--------DFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTA 156
            :..:..|..|.....|...::        |..:...|.:|.: |...||::...|||...|:: .
Human    87 SKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQM-CGGCWAFSVVGAVESAYAIK-G 149

  Fly   157 NPLPSSLSAQQLLDCAGMGTGCSTQTPLAALNYLTQLTDAYLYPEVDYP---NNNSLKTPGMCQP 218
            .|| ..||.||::||:....||:..:.|.|||:|.:: ...|..:.:||   .|      |:|..
Human   150 KPL-EDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKM-QVKLVKDSEYPFKAQN------GLCHY 206

  Fly   219 PSSVSVGVKLAGYST--VADNDDAAVMRYVSNGFPVIVEYNPATF-----GFMQY--SSGVYVQE 274
            .|....|..:.|||.  .:|.:|......::.| |::|..:..::     |.:|:  |||     
Human   207 FSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFG-PLVVIVDAVSWQDYLGGIIQHHCSSG----- 265

  Fly   275 TRALTNPKSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSN 326
                   :::..:::.|:|.  ..:..||...||:|.:||.:||..:...||
Human   266 -------EANHAVLITGFDK--TGSTPYWIVRNSWGSSWGVDGYAHVKMGSN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 11/52 (21%)
Peptidase_C1A 114..336 CDD:239068 60/233 (26%)
CTSONP_001325.1 Peptidase_C1A 109..319 CDD:239068 59/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12411
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.