DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and CTSL

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001244900.1 Gene:CTSL / 1514 HGNCID:2537 Length:333 Species:Homo sapiens


Alignment Length:343 Identity:82/343 - (23%)
Similarity:142/343 - (41%) Gaps:24/343 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLCCLLLTIDSG-WAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHNAQAD 67
            |:|....|.|.|. ..|:|..: ..:..::...|:.| ..:...:....:..|...:..||.:..
Human     5 LILAAFCLGIASATLTFDHSLE-AQWTKWKAMHNRLY-GMNEEGWRRAVWEKNMKMIELHNQEYR 67

  Fly    68 RNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAAS--DPPASQAASASFDIITDFGLTVAVED 130
            ..:.::..|:|.|.|:...:|..::....|.......  ..|....|..|.| ..:.|....|::
Human    68 EGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVD-WREKGYVTPVKN 131

  Fly   131 QGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGM--GTGCSTQTPLAALNYLTQL 193
            || .|.|.||::...|:|.....:|...:  |||.|.|:||:|.  ..||:......|..|:.. 
Human   132 QG-QCGSCWAFSATGALEGQMFRKTGRLI--SLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQD- 192

  Fly   194 TDAYLYPEVDYPNNNSLKTPGMCQ--PPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEY 256
             :..|..|..||..   .|...|:  |..||:   ...|:..: ...:.|:|:.|:...|:.|..
Human   193 -NGGLDSEESYPYE---ATEESCKYNPKYSVA---NDTGFVDI-PKQEKALMKAVATVGPISVAI 249

  Fly   257 NPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGEEGYIRI 321
            :.....|:.|..|:|.:...:..:......:|..|::.....|..||...||:|:.||..||:::
Human   250 DAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKM 314

  Fly   322 V--RRSNQPIAKNAVFPS 337
            .  ||::..||..|.:|:
Human   315 AKDRRNHCGIASAASYPT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 9/59 (15%)
Peptidase_C1A 114..336 CDD:239068 61/227 (27%)
CTSLNP_001244900.1 Inhibitor_I29 29..87 CDD:214853 9/58 (16%)
Peptidase_C1 114..332 CDD:395062 62/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.