DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsl

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_034114.1 Gene:Ctsl / 13039 MGIID:88564 Length:334 Species:Mus musculus


Alignment Length:324 Identity:83/324 - (25%)
Similarity:134/324 - (41%) Gaps:47/324 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FQTYEDNFNKTYASTSARNFANYYFIYNRNQ---VAQHNAQADRNRTTYREAVNQF-----SDIR 84
            :.|.|:.:.:.....:.|....:...|:..|   ..:.||..|.....:|:.||.:     ...|
Mouse    40 YGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGR 104

  Fly    85 LIQFAALL--PKAVNTVTSAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAV 147
            |.|...:|  ||:|:.                     .:.|....|::|| .|.|.||::.:..:
Mouse   105 LFQEPLMLKIPKSVDW---------------------REKGCVTPVKNQG-QCGSCWAFSASGCL 147

  Fly   148 EIMNAVQTANPLPSSLSAQQLLDC--AGMGTGCSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSL 210
            |....::|...:  |||.|.|:||  |....||:......|..|:.:  :..|..|..||..   
Mouse   148 EGQMFLKTGKLI--SLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKE--NGGLDSEESYPYE--- 205

  Fly   211 KTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFPVIVEYNPATFGFMQYSSGVYVQET 275
            ...|.|:..:..:| ....|:..: ...:.|:|:.|:...|:.|..:.:......||||:|.:..
Mouse   206 AKDGSCKYRAEFAV-ANDTGFVDI-PQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPN 268

  Fly   276 RALTNPKSSQFLVVVGYDHDVDSNLD-YWRCLNSFGDTWGEEGYIRIVR-RSNQ-PIAKNAVFP 336
            .:..|......||..||: ..|||.: ||...||:|..||.||||:|.: |.|. .:|..|.:|
Mouse   269 CSSKNLDHGVLLVGYGYE-GTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 13/67 (19%)
Peptidase_C1A 114..336 CDD:239068 64/226 (28%)
CtslNP_034114.1 Inhibitor_I29 29..87 CDD:214853 8/46 (17%)
Peptidase_C1 114..331 CDD:365882 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.