DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsh

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_031827.2 Gene:Ctsh / 13036 MGIID:107285 Length:333 Species:Mus musculus


Alignment Length:372 Identity:103/372 - (27%)
Similarity:153/372 - (41%) Gaps:89/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLCCLLLTIDSGWAFNHGQ---------DLVDFQTYEDNFNKTYASTSARN----FANYYFIYNR 56
            |||.      ..|..:.|.         :...|:::.....|||:|....:    |||     |.
Mouse     7 LLCA------GAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFAN-----NW 60

  Fly    57 NQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAASDPPASQAAS-------- 113
            .::..||   .||. |::.|:|||||   :.||.:..|.:      .|:|....|..        
Mouse    61 RKIQAHN---QRNH-TFKMALNQFSD---MSFAEIKHKFL------WSEPQNCSATKSNYLRGTG 112

  Fly   114 ---ASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGM- 174
               :|.|......:...|::||. |.|.|.::|..|:|  :||..|:....||:.|||:|||.. 
Mouse   113 PYPSSMDWRKKGNVVSPVKNQGA-CGSCWTFSTTGALE--SAVAIASGKMLSLAEQQLVDCAQAF 174

  Fly   175 -GTGCSTQTPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQ--PPSSVS-----VGVKLAGY 231
             ..||....|..|..|:  |.:..:..|..||   .:.....|:  |..:|:     |.:.|   
Mouse   175 NNHGCKGGLPSQAFEYI--LYNKGIMEEDSYP---YIGKDSSCRFNPQKAVAFVKNVVNITL--- 231

  Fly   232 STVADNDDAAVMRYVSNGFPVIVEYNPATFG------FMQYSSGVYVQETRALTNPKSSQFLVVV 290
                 ||:||::.       .:..|||.:|.      |:.|.||||..::...|..|.:..::.|
Mouse   232 -----NDEAAMVE-------AVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAV 284

  Fly   291 GYDHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQ-PIAKNAVFP 336
            ||..  .:.|.||...||:|..|||.||..|.|..|. .:|..|.:|
Mouse   285 GYGE--QNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 20/63 (32%)
Peptidase_C1A 114..336 CDD:239068 71/237 (30%)
CtshNP_031827.2 Inhibitor_I29 33..88 CDD:285458 22/66 (33%)
Peptidase_C1 115..330 CDD:278538 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.