DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctsc

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_034112.3 Gene:Ctsc / 13032 MGIID:109553 Length:462 Species:Mus musculus


Alignment Length:353 Identity:80/353 - (22%)
Similarity:132/353 - (37%) Gaps:85/353 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RNFANYYFIYNRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVTSAASDPPAS 109
            ||:|    .:...:|..|..:.:.|.........::|: ||........||:|||..:.:.....
Mouse   132 RNWA----CFVGKKVESHIEKVNMNAAHLGGLQERYSE-RLYTHNHNFVKAINTVQKSWTATAYK 191

  Fly   110 QAASASF-DIITDFG------------LTVAVED--------------QGVN----------CSS 137
            :....|. |:|...|            :|..::.              ||||          |.|
Mouse   192 EYEKMSLRDLIRRSGHSQRIPRPKPAPMTDEIQQQILNLPESWDWRNVQGVNYVSPVRNQESCGS 256

  Fly   138 SWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTP-LAALNYLTQL----TDAY 197
            .:::|:...:|....:.|.|.....||.|:::.|:....||....| |.|..|....    ...:
Mouse   257 CYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCF 321

  Fly   198 LYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVAD-----------NDDAAVMRYVSNGFP 251
            .|...|.|          |:|..:.     |..||  :|           |:....:..|.:| |
Mouse   322 PYTAKDSP----------CKPRENC-----LRYYS--SDYYYVGGFYGGCNEALMKLELVKHG-P 368

  Fly   252 VIVEYNPATFGFMQYSSGVYVQETRALTNP-----KSSQFLVVVGYDHDVDSNLDYWRCLNSFGD 311
            :.|.:. ....|:.|.||:|  ....|::|     .::..:::|||..|..:.::||...||:|.
Mouse   369 MAVAFE-VHDDFLHYHSGIY--HHTGLSDPFNPFELTNHAVLLVGYGRDPVTGIEYWIIKNSWGS 430

  Fly   312 TWGEEGYIRIVRRSNQPIAKNAVFPSAL 339
            .|||.||.|| ||.....|..::..:|:
Mouse   431 NWGESGYFRI-RRGTDECAIESIAVAAI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 9/42 (21%)
Peptidase_C1A 114..336 CDD:239068 65/279 (23%)
CtscNP_034112.3 CathepsinC_exc 26..138 CDD:285926 3/9 (33%)
Pox_I6 168..>204 CDD:252691 8/35 (23%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 61/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.