DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and Ctla2a

DIOPT Version :10

Sequence 1:NP_610905.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_031822.2 Gene:Ctla2a / 13024 MGIID:88554 Length:137 Species:Mus musculus


Alignment Length:96 Identity:21/96 - (21%)
Similarity:44/96 - (45%) Gaps:20/96 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLLLCCLLL--------TIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIYNRN 57
            :|.|:||..::        ::|:.|           :.::..|.|.|.....|: ....:..|:.
Mouse    16 VFLLILCLGMMSAAPPPDPSLDNEW-----------KEWKTKFAKAYNLNEERH-RRLVWEENKK 68

  Fly    58 QVAQHNAQADRNRTTYREAVNQFSDIRLIQF 88
            ::..|||..::.:|::...:|||||:...:|
Mouse    69 KIEAHNADYEQGKTSFYMGLNQFSDLTPEEF 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_610905.1 Inhibitor_I29 28..82 CDD:214853 12/53 (23%)
Peptidase_C1A 114..336 CDD:239068
Ctla2aNP_031822.2 2 X 3 AA tandem repeats of E-W-K 39..44 1/15 (7%)
Inhibitor_I29 40..98 CDD:214853 15/69 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..137
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.