DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and LOC100494325

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_031747652.1 Gene:LOC100494325 / 100494325 -ID:- Length:288 Species:Xenopus tropicalis


Alignment Length:153 Identity:42/153 - (27%)
Similarity:72/153 - (47%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QLTDAYLYPEVDYPNNNSLKTP-----GMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGFP 251
            ::.:|.....:|:...:.: ||     ..|:.....:.||.:..:...|.| :..:...|....|
 Frog   134 EILEALPPASIDWRTKDCV-TPVRNQEAQCKRKKRSNTGVVMNFHKIPAGN-ETLLKNAVGTVGP 196

  Fly   252 VIVEYNPATFGF-MQYSSGVYVQETRALTNPKSSQFLVVVGYDHDVDSNLDYWRCLNSFGDTWGE 315
            |.|..:.:..|| |..|:|:| .:....||...:  ::||||  ..::..|||...||:|...|:
 Frog   197 VSVAIDSSHQGFRMHKSAGIY-YDPYCTTNVDHA--VLVVGY--GTENGKDYWLVKNSWGIETGD 256

  Fly   316 EGYIRIVR-RSNQ-PIAKNAVFP 336
            :|||::.| |.|. .||:.|.:|
 Frog   257 KGYIKMARNRKNHCGIAQAAAYP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458
Peptidase_C1A 114..336 CDD:239068 41/151 (27%)
LOC100494325XP_031747652.1 Inhibitor_I29 51..110 CDD:214853
Peptidase_C1 141..280 CDD:419981 41/146 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.