DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and LOC100364523

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001316813.1 Gene:LOC100364523 / 100364523 RGDID:2320837 Length:343 Species:Rattus norvegicus


Alignment Length:361 Identity:91/361 - (25%)
Similarity:151/361 - (41%) Gaps:49/361 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLLLCCLLLTIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANYYFIYNRNQVAQHNAQ 65
            :|.::||  :..:....||:...| |.:|.::..:.|.| |..........:..|..::..||.:
  Rat     5 VFLIILC--VGVVSGASAFDLSLD-VQWQEWKMKYEKLY-SPEEELLKRVVWEENVKKIELHNRE 65

  Fly    66 ADRNRTTYREAVNQFSDIRLIQFAALLPKAV----NTVTSAASDPPASQAASASF--DIITDF-- 122
            ....:.||...:|.|:|:...:|..::....    ||:.|.......|...::.:  |.:..|  
  Rat    66 NSLGKNTYIMEINDFADLTDEEFKDMITGITLPINNTMKSLWKRALGSSLPNSWYWRDALPKFVD 130

  Fly   123 ----GLTVAVEDQGVNCSSSWAYATAKAVEIMNAVQTANPLPSSLSAQQLLDCAGM--GTGCSTQ 181
                |....|..|| .|:|.||:....|:|.....:|....|  ||.|.|:||:..  ..||...
  Rat   131 WRKEGYVTHVRVQG-RCNSCWAFPVVGAIEGQMFKKTGKLTP--LSVQNLVDCSKPQGNKGCRGG 192

  Fly   182 TPLAALNYLTQLTDAYLYPEVDYPNNNSLKTPGMCQ--PPSSVSVGVKLAGYSTVADNDDAAVMR 244
            |...|..|:.|  :..|..|..||....   .|:|:  |.:|   ..|:..:..:.:|:| .:|.
  Rat   193 TTYNAFQYVLQ--NGGLESEATYPYEGK---EGLCRYNPNNS---SAKITRFVALPENED-VLMD 248

  Fly   245 YVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQF----LVVVGY---DHDVDSNLDY 302
            .|:...||....:........|..|:|.:       ||.:.:    ::||||   .::.|.| :|
  Rat   249 AVATKGPVAAGIHVVHSSLRFYKKGIYHE-------PKCNNYVNHAVLVVGYGFEGNETDGN-NY 305

  Fly   303 WRCLNSFGDTWGEEGYIRIVRRSNQ--PIAKNAVFP 336
            |...||:|:.||..||::|.:..|.  .||..|.:|
  Rat   306 WLIQNSWGERWGLNGYMKIAKDRNNHCGIATFAQYP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458 12/59 (20%)
Peptidase_C1A 114..336 CDD:239068 66/242 (27%)
LOC100364523NP_001316813.1 Inhibitor_I29 29..87 CDD:214853 12/58 (21%)
Peptidase_C1A 126..341 CDD:239068 65/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.