DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6337 and ctsz

DIOPT Version :9

Sequence 1:NP_001286395.1 Gene:CG6337 / 36530 FlyBaseID:FBgn0033873 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001106427.1 Gene:ctsz / 100127597 XenbaseID:XB-GENE-959211 Length:296 Species:Xenopus tropicalis


Alignment Length:213 Identity:55/213 - (25%)
Similarity:89/213 - (41%) Gaps:49/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CSSSWAYATAKAVEIMNAVQTANPLPSS-LSAQQLLDCAGMGT----------------GCSTQT 182
            |.|.||:.:..|:.....::.....||: ||.|.::|||..|:                |...:|
 Frog    80 CGSCWAHGSTSAMADRINIKRKGVWPSAYLSVQHVIDCANAGSCEGGDHGGVWEYANSHGIPDET 144

  Fly   183 PLAALNYLTQLTDAYLYPEVDYPNN-NSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYV 246
               ..||  |..|    .:.|..|. .:..|.|.|...|:.::. |:..:.:|:..:......| 
 Frog   145 ---CNNY--QARD----QKCDKFNQCGTCVTFGKCFYLSNYTLW-KVGDFGSVSGREKMMAEIY- 198

  Fly   247 SNGFPVIVEYNPATFGFM------QYSSGVYVQ-ETRALTNPKSSQFLVVVGYDHDVDSNLDYWR 304
            .||        |.:.|.|      .|:.|:|.: :..|:.|    ..:.|.|:..| :|..:||.
 Frog   199 KNG--------PISCGIMATEKLDAYTGGLYAEYQPSAMIN----HIVSVAGWGLD-ESGAEYWI 250

  Fly   305 CLNSFGDTWGEEGYIRIV 322
            ..||:|:.|||.|::|||
 Frog   251 VRNSWGEPWGERGWLRIV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6337NP_001286395.1 Inhibitor_I29 28..88 CDD:285458
Peptidase_C1A 114..336 CDD:239068 55/213 (26%)
ctszNP_001106427.1 Peptidase_C1A_CathepsinX 53..294 CDD:239149 55/213 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.