DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and Cpr92A

DIOPT Version :10

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:151 Identity:50/151 - (33%)
Similarity:62/151 - (41%) Gaps:34/151 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLSLS-LAAISAYAYA-QIAPGSNAYLPPTKNGYDYSEPKTPFKPGP--------PGRPAAPGPR 63
            :|.:| |:|:...||| .|.||      |...|        |..|||        |.....|||.
  Fly     1 MLKISLLSAMLGIAYAGVIGPG------PYYGG--------PAGPGPLHHYGGYAPQHGPLPGPY 51

  Fly    64 PPAPPGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGR 128
            ....|..|     :|.|     |...|.|.|.:||..|.:..:...:..||||.|.|.|..|||.
  Fly    52 VAPKPAAP-----EPYD-----PDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGT 106

  Fly   129 TQIVRYTADWKTGYHADVSYE 149
            .:.|.||||...|::|.|..|
  Fly   107 KRTVDYTADPHHGFNAVVRKE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:459790 21/51 (41%)
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 21/51 (41%)

Return to query results.
Submit another query.