DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and Ccp84Ae

DIOPT Version :9

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:95 Identity:34/95 - (35%)
Similarity:45/95 - (47%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RPAAPGPRPPAP-PGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGE 119
            |.|||.....|| |...:.:..:..|.|..     |.:.|.|||..:.::..|....|||||.||
  Fly    21 RTAAPVAVASAPVPVLAKTVELEEVDPHPQ-----YTYSYDVQDTLSGDNKGHVEERDGDVVRGE 80

  Fly   120 YRVQMPDGRTQIVRYTADWKTGYHADVSYE 149
            |.:...||..:.|.||||...|::|.|..|
  Fly    81 YSLIDADGFKRTVTYTADSINGFNAVVRRE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 21/51 (41%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.