DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and Ccp84Ag

DIOPT Version :9

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:86 Identity:27/86 - (31%)
Similarity:38/86 - (44%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYE- 149
            |...|.:.|.|:|..:.:......:.:||||.|:|.:...||..:||.||||...|::|.|..| 
  Fly    38 PHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREP 102

  Fly   150 -------GEATYPQGPQPGAR 163
                   ..|.....|.|..|
  Fly   103 LVAAVAAAPAAVVAAPAPVVR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 18/51 (35%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.