DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and Cpr72Eb

DIOPT Version :10

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:79 Identity:20/79 - (25%)
Similarity:31/79 - (39%) Gaps:11/79 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EYAVQDPETANDYAHKA---------SSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSY 148
            :|..||......|.:.|         :.|| |:.|.:.....:|.||.|.|.|| ..|:|...:.
  Fly    35 QYHHQDEHGQYAYGYMAPLYSKHETRTVDG-VIRGTFSHIDANGETQTVDYVAD-AEGFHVTSNL 97

  Fly   149 EGEATYPQGPQPGA 162
            ..:....:.|:..|
  Fly    98 PNQQANQETPEVAA 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:459790 16/57 (28%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:459790 13/47 (28%)

Return to query results.
Submit another query.