DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and Cpr67B

DIOPT Version :9

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:191 Identity:43/191 - (22%)
Similarity:65/191 - (34%) Gaps:65/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KSFVLLSLSLAAISAYAYAQIAPGSNAY---LPPTK-------------NGYDYSEPKTPFKPGP 53
            |.::|.:|.||.        :|.|.|.:   :.|.:             ...:|: |||      
  Fly     2 KCYILAALLLAT--------LASGENIFKINITPEEAQQFLNSAQLRGIGDIEYA-PKT------ 51

  Fly    54 PGRPAAPGPRPPAPPGTPRNIPGQ----------PGDDHV--HVPGMPY-------DFEYAVQDP 99
                 ...|.|.|     ||..|:          | :::|  |.....|       .|.|..:| 
  Fly    52 -----GENPLPEA-----RNEKGEFVYMGRVIEHP-EEYVEEHYDAHQYHGQDGLGQFAYGYRD- 104

  Fly   100 ETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEGEATYPQGPQP 160
              .|...::...:...|||.|:...|.||..:..|.|| |||:|.:.:.......|....|
  Fly   105 --WNQGKNEKRDETGKVTGSYKYVQPHGRDFVANYYAD-KTGFHVEDNRPAHLKLPATKTP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 17/58 (29%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.