DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and CG13670

DIOPT Version :9

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:132 Identity:42/132 - (31%)
Similarity:57/132 - (43%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GYDYSEPKTPFKPGPPGRPAAPGPRPPAPPGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPETAN 103
            ||.|:..:.|          ..||.........|.:      |:|..|  .|.|.|.|:|.:|..
  Fly    70 GYSYARFEGP----------VVGPEHLVTVHDGRTV------DYVARP--EYSFAYGVEDGKTRV 116

  Fly   104 DYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEGEATYPQGPQPGARGGGGG 168
            ....|.:.:||.|.|.|.|..|||..::|:||||...|:.|:|...|..|. .|  .|:.|..||
  Fly   117 LQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAEVITNGVKTL-HG--HGSDGDAGG 178

  Fly   169 GA 170
            |:
  Fly   179 GS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 21/51 (41%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 21/51 (41%)
Paf1 <215..265 CDD:281915
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.