DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and Cpr57A

DIOPT Version :10

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:68 Identity:22/68 - (32%)
Similarity:32/68 - (47%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VPGMPYDFEYAVQDPETANDYAHKASSDGD-VVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSY 148
            ||..||.|.|.........|..|...|||. |:.|.:....|..:.:.|:|.|| :.|:|..:|:
  Fly    27 VPASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVAD-EHGFHPQLSH 90

  Fly   149 EGE 151
            :.|
  Fly    91 KLE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:459790 15/52 (29%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 15/52 (29%)

Return to query results.
Submit another query.