DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and Cpr51A

DIOPT Version :10

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:75 Identity:22/75 - (29%)
Similarity:27/75 - (36%) Gaps:11/75 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRT-QIVRYTADWKTGYHA------DVS 147
            |.|..:|.|.......:.....:|..|.|.|  ...||.. :.|.|.|| |.||..      ||.
  Fly    44 YSFNSSVDDKINDGQISRNEEREGGTVRGSY--SYFDGFVKRRVEYIAD-KDGYRVLKDEIEDVG 105

  Fly   148 YEGEATYPQG 157
             .|.:..|.|
  Fly   106 -NGPSFNPDG 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:459790 15/52 (29%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:459790 15/52 (29%)

Return to query results.
Submit another query.