DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Cb and LOC1272517

DIOPT Version :10

Sequence 1:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_061512344.1 Gene:LOC1272517 / 1272517 VectorBaseID:AGAMI1_009692 Length:500 Species:Anopheles gambiae


Alignment Length:74 Identity:33/74 - (44%)
Similarity:43/74 - (58%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YDFEYAVQDPETANDYAHKASSDGD-VVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEGEAT 153
            |.|.|.|:|..:.:|::|......| .|.|.|:|.:||||.|||:|.|| ..||.|||:||.|  
Mosquito   163 YVFSYTVKDTASGDDFSHTQQQHQDGAVKGSYKVHLPDGRMQIVKYIAD-NNGYRADVTYENE-- 224

  Fly   154 YPQGPQPGA 162
             |.|..|.:
Mosquito   225 -PAGVVPAS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:459790 22/52 (42%)
LOC1272517XP_061512344.1 None

Return to query results.
Submit another query.