DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap7 and CG32061

DIOPT Version :10

Sequence 1:NP_610900.1 Gene:S-Lap7 / 36524 FlyBaseID:FBgn0033868 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_729611.1 Gene:CG32061 / 39196 FlyBaseID:FBgn0052061 Length:214 Species:Drosophila melanogaster


Alignment Length:46 Identity:14/46 - (30%)
Similarity:19/46 - (41%) Gaps:7/46 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 WKQFQRAGSISG------DRVWRLPLW-QYYRRQVTDERAYDLSNN 458
            |:..|..|.:.|      ..|..:|.| |.....|:.|:|..||.|
  Fly   159 WRAIQLYGELQGLFWHRSTSVTLIPYWSQIIGGGVSLEKASHLSGN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap7NP_610900.1 Peptidase_M17_N 43..172 CDD:426984
Peptidase_M17 205..513 CDD:459978 14/46 (30%)
CG32061NP_729611.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.