DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:155 Identity:40/155 - (25%)
Similarity:61/155 - (39%) Gaps:50/155 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 SNGYEGVTNAEEPVTTVEHVVHH--PTVATQLHHQVLLPKQQHHHHQQQHHGLVATVLPAELDSD 727
            |.||       .|:...:  |:|  |.|||..|..|.:.::              .|:       
  Fly    16 SAGY-------APIAAPQ--VYHAAPAVATYAHAPVAVAQK--------------VVV------- 50

  Fly   728 KGVNGLHFVNSDEDKSLQQY--ASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGR 790
                          |:.::|  ..:|.|.|.:.|..||::.|..:.|| ..|.||:|.::..||.
  Fly    51 --------------KAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEERD-GDVVRGEYSLIDADGY 100

  Fly   791 IQNVIYHADD-TGFHADVSFEGATK 814
            .:.|.|.||. .||:|.|:.|...|
  Fly   101 KRIVQYTADPINGFNAVVNREPLVK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 19/52 (37%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.