DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:248 Identity:64/248 - (25%)
Similarity:85/248 - (34%) Gaps:71/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 APQLTTTTPRVEDNDILTGEATAETKRMYVYKEAPVNSGHVKTKKSLSTLPHEVQKVISQLMKDG 358
            |||:....|.|         ||        |..|||........|:........|...|..:.|.
  Fly    24 APQVYHAAPAV---------AT--------YAHAPVAVAQKVVVKAAEEYDPHPQYRFSYGVDDK 71

  Fly   359 LGG--KAYVK-----YLPAQKS--DYEHYKAKSLSYGGKPLVNYVKYINK-PAEPAASPSPVQVH 413
            |.|  |..|:     .:..:.|  |.:.|| :::.|...|:..:...:|: |...|.:.:|| |.
  Fly    72 LTGDNKGQVEERDGDVVRGEYSLIDADGYK-RTVQYTADPINGFNAVVNREPLVKAVAVAPV-VK 134

  Fly   414 IQPVPVVEQLRYVYKPHYA--AVAPTIAQPIVVQEAPAPTAAVEEVHH--------TYTAELAPP 468
            ....||. |.......|||  ||..|:| |:....|||....|..|.|        ||.|     
  Fly   135 TVAAPVA-QYAAPAVAHYAAPAVVKTVA-PVAHYAAPAVVKTVAPVAHYAAPAAYATYAA----- 192

  Fly   469 PTQSVEVVVPQFRPSKPDPLLAEAPAIYGKPQEAYNSYELQPEASPLIKIEYH 521
            ||...                  |||.|..|...|.||     ::|  .:.||
  Fly   193 PTHYA------------------APAHYAAPAATYTSY-----SAP--AVAYH 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.