DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:171 Identity:47/171 - (27%)
Similarity:69/171 - (40%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 YKEAPVNSGH---VKTKKSLSTLPHEVQKVISQLMKDGLGG--KAYVK-----YLPAQKS--DYE 376
            |.:|||...|   |..|.:....||...|.... ::|.|.|  |:.|:     .:..:.|  |.:
  Fly    35 YAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYD-VQDSLSGDSKSQVEERDGDVVRGEYSLIDAD 98

  Fly   377 HYKAKSLSYGGKPLVNYVKYINK-PAEPAASPSPVQVHIQPVPVVEQLRYVYKPHYAA------V 434
            .|| :::.|...|:..:...:|: |...|.:.:|| |.....||.         ||||      .
  Fly    99 GYK-RTVQYTADPINGFNAVVNREPLVKAVAVAPV-VKTVAAPVA---------HYAAPAVAHYA 152

  Fly   435 APTIAQ---PIVVQEAPAPTAAVEEVHH-----TYTAELAP 467
            ||.:.:   |:....|||....|..|.|     |||:..||
  Fly   153 APAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPATYTSYAAP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669 25/82 (30%)
Chitin_bind_4 751..803 CDD:459790
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.