DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:62 Identity:23/62 - (37%)
Similarity:36/62 - (58%) Gaps:2/62 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 KYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHADD-TGFHADVSFE 810
            :|.:.|.::|..:|::.||.:.|| ..|.||:|.::..||..:.|.|.||. .||:|.|..|
  Fly    50 QYTYSYDVQDTLSGDNKGHVEERD-GDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRRE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 18/52 (35%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.