DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Af

DIOPT Version :9

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:149 Identity:34/149 - (22%)
Similarity:54/149 - (36%) Gaps:52/149 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 VTNAEEPVTTVEHVVH-HPTVATQ-------LHHQVLLPK--QQHHHHQQQHHGLVATVLPAELD 725
            ::.|...|..|:.|.| .|.|||.       .|.|.:|.|  :::..|.|               
  Fly    12 ISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQ--------------- 61

  Fly   726 SDKGVNGLHFVNSDEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGR 790
                                     |:|.|.::|..:|:.....:.|| ..|..|:|.::..||.
  Fly    62 -------------------------YKFAYDVQDSLSGDSKSQVEERD-GDVVHGEYSLIDSDGY 100

  Fly   791 IQNVIYHADD-TGFHADVS 808
            .:.|.|.:|. .||:|.|:
  Fly   101 KRIVQYTSDPVNGFNAVVN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 15/52 (29%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.