DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Ccp84Af

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:149 Identity:34/149 - (22%)
Similarity:54/149 - (36%) Gaps:52/149 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 VTNAEEPVTTVEHVVH-HPTVATQ-------LHHQVLLPK--QQHHHHQQQHHGLVATVLPAELD 725
            ::.|...|..|:.|.| .|.|||.       .|.|.:|.|  :::..|.|               
  Fly    12 ISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQ--------------- 61

  Fly   726 SDKGVNGLHFVNSDEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGR 790
                                     |:|.|.::|..:|:.....:.|| ..|..|:|.::..||.
  Fly    62 -------------------------YKFAYDVQDSLSGDSKSQVEERD-GDVVHGEYSLIDSDGY 100

  Fly   791 IQNVIYHADD-TGFHADVS 808
            .:.|.|.:|. .||:|.|:
  Fly   101 KRIVQYTSDPVNGFNAVVN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 15/52 (29%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.