| Sequence 1: | NP_610899.1 | Gene: | Cpr50Ca / 36523 | FlyBaseID: | FBgn0033867 | Length: | 815 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611489.1 | Gene: | Cpr57A / 37319 | FlyBaseID: | FBgn0034517 | Length: | 184 | Species: | Drosophila melanogaster |
| Alignment Length: | 61 | Identity: | 21/61 - (34%) |
|---|---|---|---|
| Similarity: | 30/61 - (49%) | Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 748 ASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHADDTGFHADVS 808 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpr50Ca | NP_610899.1 | PRK10263 | <400..>653 | CDD:236669 | |
| Chitin_bind_4 | 751..803 | CDD:459790 | 15/51 (29%) | ||
| Cpr57A | NP_611489.1 | Chitin_bind_4 | 32..84 | CDD:459790 | 15/51 (29%) |
| Blue background indicates that the domain is not in the aligned region. | |||||