DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Cpr57A

DIOPT Version :10

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:61 Identity:21/61 - (34%)
Similarity:30/61 - (49%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 ASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHADDTGFHADVS 808
            ||.|.|.|:........|..|.:..|..||.||.:..:.|..:::.|.|.||:.|||..:|
  Fly    29 ASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLS 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 15/51 (29%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.