DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Cpr56F

DIOPT Version :9

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:81 Identity:35/81 - (43%)
Similarity:51/81 - (62%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   731 NGLHFVNSDEDKSLQQYA-SKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNV 794
            ||..:...||    :||. :||||.|.::|:.:||||||.::|| ..:..|:|::||||||.|.|
  Fly   111 NGNGYGQRDE----EQYGPAKYEFKYDVQDYESGNDFGHMESRD-GDLAVGRYYVLLPDGRKQIV 170

  Fly   795 IYHADDTGFHADVSFE 810
            .|.||..|:...:.:|
  Fly   171 EYEADQNGYRPTIRYE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 26/51 (51%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115878at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.