DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Crys

DIOPT Version :9

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:118 Identity:39/118 - (33%)
Similarity:56/118 - (47%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   700 LPKQQHHHHQQQHHGLVATVLPAELDSDKGVNGLHFVNSDED------KSLQQYASK--YEFGYR 756
            |.|..:...|||..      |...|:.|..       |.|:|      .|.:.|.::  |.|.|.
  Fly    31 LAKSSNLQQQQQQQ------LRGALNRDDN-------NDDDDATTLAPNSNEDYDTRPQYSFAYD 82

  Fly   757 IRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHADD-TGFHADVS 808
            :||..||:|...::.|| ..:.:|||.::.|||..:.|.|.||| :||:|.||
  Fly    83 VRDSLTGDDKRQEEKRD-GDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVS 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 21/52 (40%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.