DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr50Ca and Cpr31A

DIOPT Version :9

Sequence 1:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:321 Identity:73/321 - (22%)
Similarity:98/321 - (30%) Gaps:127/321 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 YVKYLPAQKSDYEHYKAKSLSYGGKPLVNYVKYINK---------PAEPA-----ASPSPVQVHI 414
            |..|.||    |..|:|.:..|...|:.....|...         ||.|.     |.|:||...:
  Fly    26 YAGYHPA----YATYQAPAAVYHAAPVAQAAVYQQAAPVYAKTFVPAAPVYTRSYALPTPVVKAV 86

  Fly   415 QP--------VPVVEQLRYVYKPHYAAVAPTIAQPIV--VQEAPAPTAAVE-----------EVH 458
            .|        .|||:.|         |.||.:|.|:|  |..|||....||           .||
  Fly    87 APAPLALPVAAPVVKTL---------AAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVH 142

  Fly   459 H----------------------------------TYTAE---------LAPPPTQSVEVVVPQF 480
            .                                  ||||:         ...|...:..|..|..
  Fly   143 DSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARAVAAPVV 207

  Fly   481 RPSKPDPL--------LAEAPA-IYGKPQEAYNSYELQPEASPLIKIEYHAQPDGINEHYKQLPE 536
            ..|.|.|:        :|..|| ||...|:.:...::|..|        ..|.:.:.....|.||
  Fly   208 SVSAPAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVA--------EQQGEVVESPVAQQPE 264

  Fly   537 FQQLSTLIGKSPDDQIHGLTYLLAKEMQAKLQRQGKQLVDRPQDSTAPILFHPGQGASPAP 597
            .:       .:|.|...|           :.|:|.:|....|||...| .:.|...:||||
  Fly   265 LE-------PTPIDYNEG-----------QQQQQEQQQQTYPQDQQFP-PYSPAGQSSPAP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 6/51 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.