DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Cadm3

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001399743.1 Gene:Cadm3 / 94332 MGIID:2137858 Length:430 Species:Mus musculus


Alignment Length:343 Identity:82/343 - (23%)
Similarity:138/343 - (40%) Gaps:72/343 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PNPYEAEEMSVVY------AEQHSE-------------IKLMCEV-DLDIATSMWYKNGQVVHAM 279
            |.|.|....|.|:      |.|.|:             :.|.|:| |.:.::..|....|.....
Mouse    40 PAPLEEALSSTVWSNPDLLASQDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYF 104

  Fly   280 DRTARVTDYRFIKEANG----ALTITNVMLEDDGKWQCEAENTRRYTENARPVK--LVVLDRPKP 338
            .....:.|.|....::.    :::|:||.|.|:|::.|..     :|...|..|  :.||..|:.
Mouse   105 GEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSI-----FTMPVRTAKSLVTVLGIPQK 164

  Fly   339 PYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELE 403
            |.:         :.....::|.....|.|.|.|..|...|||.        :..|::..:...::
Mouse   165 PII---------TGYKSSLREKETATLNCQSSGSKPAAQLTWR--------KGDQELHGDQTRIQ 212

  Fly   404 EIKGEKLDKDG--YKINSGAKSEARLPAVYRAHHNARILCVMEHPTLK-IRQNASLLLDVQYTPS 465
            |      |.:|  :.::|....:     |.|....|.|:|.:.|.:|| ..::.|..::|.|||:
Mouse   213 E------DPNGKTFTVSSSVSFQ-----VTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPT 266

  Fly   466 FAISRTPGFGYPLREGIEVSLKCDVDSNP-PSTPRWQKDDGDTPVPQTGDGFLNFTSIRREHSGW 529
            ..|...|  .:| |||.::.|.|:...|| |....|.|:..:.|:..|.:..|.|..:.:..||.
Mouse   267 AMIRPEP--AHP-REGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGT 328

  Fly   530 YKCTSRHLNFQYSSIGYY 547
            |.||:.      |::|.|
Mouse   329 YGCTAT------SNMGSY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/113 (20%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 0/7 (0%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 22/95 (23%)
Ig_3 478..533 CDD:464046 17/55 (31%)
IG_like 578..660 CDD:214653
Cadm3NP_001399743.1 IgV_1_Necl-1 64..158 CDD:143290 18/98 (18%)
Ig strand A 64..67 CDD:143290 0/2 (0%)
FR1 65..83 CDD:143290 1/17 (6%)
Ig strand A' 68..74 CDD:143290 0/5 (0%)
Ig strand B 76..84 CDD:143290 2/7 (29%)
CDR1 84..89 CDD:143290 2/4 (50%)
FR2 90..97 CDD:143290 1/6 (17%)
Ig strand C 90..96 CDD:143290 1/5 (20%)
CDR2 98..109 CDD:143290 1/10 (10%)
Ig strand C' 100..104 CDD:143290 0/3 (0%)
Ig strand C' 106..109 CDD:143290 0/2 (0%)
FR3 110..145 CDD:143290 9/39 (23%)
Ig strand D 114..121 CDD:143290 1/6 (17%)
Ig strand E 124..130 CDD:143290 0/5 (0%)
Ig strand F 137..145 CDD:143290 2/12 (17%)
CDR3 146..149 CDD:143290 1/2 (50%)
Ig strand G 149..158 CDD:143290 2/8 (25%)
FR4 151..158 CDD:143290 1/6 (17%)
Ig 159..261 CDD:472250 26/129 (20%)
Ig strand B 180..184 CDD:409353 1/3 (33%)
Ig strand C 194..198 CDD:409353 2/3 (67%)
Ig strand E 224..228 CDD:409353 1/3 (33%)
Ig strand F 238..243 CDD:409353 2/4 (50%)
Ig strand G 254..257 CDD:409353 0/2 (0%)
IG_like 271..348 CDD:214653 24/79 (30%)
Ig strand B 282..286 CDD:409353 1/3 (33%)
Ig strand C 296..300 CDD:409353 0/3 (0%)
Ig strand E 314..318 CDD:409353 1/3 (33%)
Ig strand F 328..333 CDD:409353 2/4 (50%)
4.1m 386..401 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.