DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Ceacam1

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001029032.1 Gene:Ceacam1 / 81613 RGDID:67396 Length:519 Species:Rattus norvegicus


Alignment Length:506 Identity:100/506 - (19%)
Similarity:166/506 - (32%) Gaps:165/506 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 TTVQATSSSSSATRSSVINET-KAKRPRSTLHLAPEDMQPKPKEPVIIIDDVEEFDSGTSTSDLI 206
            ||:...|..:...||..:::| .|...|.|::          ....:...:|.:.|....|..:.
  Rat    71 TTLNPDSEIARYIRSDNMSKTGPAYSGRETIY----------SNGSLFFQNVNKTDERAYTLSVF 125

  Fly   207 ARKSREEAEEEEDEGPLEP----RVLPLRPVP------PNPYEAEEMSVVYAEQHSEIKLMCEVD 261
                      ::...|::.    ||.|....|      .||.|.|..          :.||||..
  Rat   126 ----------DQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPF----------VSLMCEPY 170

  Fly   262 LDIATSMWYKNGQVVHAMDRTARVTDYRFIKEANGALTITNVMLEDDGKWQCEAENTRRYTENAR 326
            .:..:.:|.:||:.:...||..       ..|.|..||:.||...|.|.::|||.|...: ..:.
  Rat   171 TNNTSYLWSRNGESLSEGDRVT-------FSEGNRTLTLLNVRRTDKGYYECEARNPATF-NRSD 227

  Fly   327 PVKLVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRH 391
            |..|.|:..|..|.:         |...:.:.:.|.|||:|.:: .||.....|.:       ..
  Rat   228 PFNLDVIYGPDAPVI---------SPPDIYLHQGSNLNLSCHAD-SNPPAQYFWLI-------NE 275

  Fly   392 AQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASL 456
            ..:.|::.|.:..|...         |||         .|....| ..:..:...|:|   |.::
  Rat   276 KLQTSSQELFISNITTN---------NSG---------TYACFVN-NTVTGLSRTTVK---NITV 318

  Fly   457 LLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNPPSTPRWQKDDG---------------D 506
            ...|. .||..|:.|     .::|...|:|.|           :.||.|               |
  Rat   319 FEPVT-QPSIQITNT-----TVKELGSVTLTC-----------FSKDTGVSVRWLFNSQSLQLTD 366

  Fly   507 TPVPQTGDGFLNFTSIRREHSGWYKC-TSRHLNFQYS---------------------------- 542
            .......:..|....|:||.:|.|:| .|..::|:.|                            
  Rat   367 RMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVI 431

  Fly   543 ----------SIGYYLSVR-----FDSVDVTS-EPDDQDVSVAAASHNPNK 577
                      ::.|:|..|     .|..|:|. :|.....::..:..:|||
  Rat   432 GSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSPNK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/87 (26%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 18/92 (20%)
Ig_3 478..533 CDD:464046 15/70 (21%)
IG_like 578..660 CDD:214653 100/506 (20%)
Ceacam1NP_001029032.1 IgV_CEACAM_D1 36..140 CDD:409430 13/88 (15%)
FR1 37..55 CDD:409430
Ig strand A 37..39 CDD:409430
Required for homophilic binding. /evidence=ECO:0000269|PubMed:8831574 39..142 15/90 (17%)
Ig strand A' 44..46 CDD:409430
Ig strand B 49..56 CDD:409430
CDR1 56..63 CDD:409430
FR2 64..69 CDD:409430
Ig strand C 64..68 CDD:409430
CDR2 70..91 CDD:409430 5/19 (26%)
Ig strand C' 78..83 CDD:409430 0/4 (0%)
Ig strand C' 88..91 CDD:409430 0/2 (0%)
FR3 98..124 CDD:409430 5/35 (14%)
Ig strand D 98..103 CDD:409430 2/14 (14%)
Ig strand E 105..109 CDD:409430 0/3 (0%)
Ig strand F 119..124 CDD:409430 1/4 (25%)
CDR3 125..132 CDD:409430 0/16 (0%)
FR4 133..140 CDD:409430 0/6 (0%)
Ig strand G 133..139 CDD:409430 0/5 (0%)
IgI_hCEACAM_2_4_6_like 146..234 CDD:409402 28/105 (27%)
Ig strand A 146..150 CDD:409402 1/3 (33%)
Ig strand A' 153..158 CDD:409402 2/4 (50%)
Ig strand B 163..169 CDD:409402 3/5 (60%)
Ig strand C 176..181 CDD:409402 1/4 (25%)
Ig strand C' 183..186 CDD:409402 0/2 (0%)
Ig strand D 190..194 CDD:409402 1/10 (10%)
Ig strand E 197..202 CDD:409402 2/4 (50%)
Ig strand F 212..220 CDD:409402 3/7 (43%)
Ig strand G 224..233 CDD:409402 2/8 (25%)
IgC2_CEACAM5-like 243..318 CDD:409540 20/104 (19%)
Ig strand A 243..249 CDD:409540 1/5 (20%)
Ig strand B 254..261 CDD:409540 4/6 (67%)
Ig strand C 267..273 CDD:409540 1/5 (20%)
Ig strand C' 276..281 CDD:409540 0/4 (0%)
Ig strand E 284..290 CDD:409540 1/5 (20%)
Ig strand F 293..304 CDD:409540 5/20 (25%)
Ig strand G 307..318 CDD:409540 3/13 (23%)
IgI_hCEACAM_2_4_6_like 324..411 CDD:409402 22/102 (22%)
Ig strand A 324..328 CDD:409402 2/3 (67%)
Ig strand A' 331..335 CDD:409402 1/8 (13%)
Ig strand B 340..346 CDD:409402 3/16 (19%)
Ig strand C 353..358 CDD:409402 0/4 (0%)
Ig strand C' 360..363 CDD:409402 0/2 (0%)
Ig strand D 367..371 CDD:409402 0/3 (0%)
Ig strand E 374..379 CDD:409402 1/4 (25%)
Ig strand F 389..397 CDD:409402 3/7 (43%)
Ig strand G 401..410 CDD:409402 1/8 (13%)
Interaction with calmodulin. /evidence=ECO:0000269|PubMed:8576129 445..457 3/11 (27%)
Interaction with FLNA. /evidence=ECO:0000269|PubMed:16291724 447..519 9/36 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..519 7/28 (25%)
Required for interaction with PTPN11 and PTPN6 and for control of phosphorylation level. /evidence=ECO:0000250|UniProtKB:P31809 484..519
Essential for interaction with PTPN11 and PTPN6. /evidence=ECO:0000250|UniProtKB:P31809 513..516
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.