DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and cadm2a

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_005155320.1 Gene:cadm2a / 793954 ZFINID:ZDB-GENE-040426-1614 Length:442 Species:Danio rerio


Alignment Length:358 Identity:91/358 - (25%)
Similarity:138/358 - (38%) Gaps:78/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 LMCEVDLDIATSMWYKN--GQVVHAMDRTA-RVTDYRFIKEANGALT--ITNVMLEDDGKWQCEA 315
            |.|.|:.:..||:.:.|  .|.:...|:.| |......::..:..||  |:.|.|.|:|.:.|..
Zfish    57 LTCRVEHNDNTSLQWSNPAQQTLFFGDKKALRDNRIELVRATSQELTISISEVSLSDEGLYTCSL 121

  Fly   316 ENTRRYTENARPVK-----LVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNPR 375
                 :|   .|||     |.||..||.|         :.:.|..||.|...:.|.||:.|..|.
Zfish   122 -----FT---MPVKTAKAFLTVLGVPKKP---------EINGLTKPVLEGDHITLTCVTSGSKPA 169

  Fly   376 PTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSG-----AKSEARLPAVYRAHH 435
            ..:.|              ...|:    |:||.|      ::|:.     .||..|| .|.|...
Zfish   170 ADVRW--------------FKNEM----EVKGAK------EVNASGKTFTVKSSLRL-HVNRDDD 209

  Fly   436 NARILCVMEHPTL-KIRQNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNP-PSTP 498
            .....|.::|..| ...:..:.:|:|.|.|...|.::....   :||..:.|:|....|| |...
Zfish   210 GVAYTCRVDHVALTATHEETTQVLEV
HYAPYVEIRQSTNVP---QEGQYLKLQCVPKGNPSPDPV 271

  Fly   499 RWQKDDGDTP-----VPQTGDGFLNFTSIRREHSGWYKC-TSRHLNFQYSSIGYYLSVRFDSVDV 557
            .|.||.|:.|     :....|  |.|||:.:..:|.|:| .:.||...::.....:      .|.
Zfish   272 LWTKDGGELPDMDRMIVDGRD--LTFTSLNKTDNGTYRCEATNHLGTSHAEFKLVI------YDA 328

  Fly   558 TSEPDDQDVSVAAASHNPNKGQLE-VQLGGAVT 589
            .:.|.....|.|....: ..|.|: .||..|||
Zfish   329 PTTPSPSTTSPAPTLPD-TTGPLDSKQLNSAVT 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/85 (27%)
Ig strand B 254..258 CDD:409353 1/1 (100%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 2/5 (40%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 22/98 (22%)
Ig_3 478..533 CDD:464046 20/61 (33%)
IG_like 578..660 CDD:214653 7/13 (54%)
cadm2aXP_005155320.1 IgV_1_Necl-3 41..136 CDD:409498 23/86 (27%)
Ig strand A 41..44 CDD:409498
FR1 42..60 CDD:409498 1/2 (50%)
Ig strand A' 45..51 CDD:409498
Ig strand B 53..61 CDD:409498 2/3 (67%)
CDR1 61..66 CDD:409498 1/4 (25%)
FR2 67..74 CDD:409498 2/6 (33%)
Ig strand C 67..73 CDD:409498 2/5 (40%)
CDR2 75..86 CDD:409498 2/10 (20%)
Ig strand C' 77..81 CDD:409498 1/3 (33%)
Ig strand C' 83..86 CDD:409498 1/2 (50%)
FR3 87..122 CDD:409498 9/39 (23%)
Ig strand D 91..98 CDD:409498 0/6 (0%)
Ig strand E 101..107 CDD:409498 2/5 (40%)
Ig strand F 114..122 CDD:409498 2/12 (17%)
CDR3 123..126 CDD:409498 1/5 (20%)
Ig strand G 126..136 CDD:409498 3/9 (33%)
FR4 128..135 CDD:409498 1/6 (17%)
Ig 135..235 CDD:472250 31/133 (23%)
Ig strand B 157..161 CDD:409353 1/3 (33%)
Ig strand C 171..175 CDD:409353 1/17 (6%)
Ig strand E 198..202 CDD:409353 1/3 (33%)
Ig strand F 212..217 CDD:409353 1/4 (25%)
Ig strand G 228..231 CDD:409353 0/2 (0%)
Ig_3 239..312 CDD:464046 22/77 (29%)
4.1m 395..413 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.