DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17716 and bcam

DIOPT Version :9

Sequence 1:NP_001286391.1 Gene:CG17716 / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001352817.1 Gene:bcam / 767689 ZFINID:ZDB-GENE-060929-620 Length:611 Species:Danio rerio


Alignment Length:468 Identity:114/468 - (24%)
Similarity:194/468 - (41%) Gaps:123/468 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 TDYRFIKEANGALTITNVMLEDDGKWQCE--------AENTRRYTENARPVKLVVLDRPKPPYLL 342
            || |:..|.:.:|.|:.|.::|..|:.|:        ||:.......:.|.|.:|:  |.|..:.
Zfish    87 TD-RYTIEKDMSLNISQVTVDDHKKFICQVTAGPVGTAESATEVKVFSAPEKPMVV--PNPQKIF 148

  Fly   343 IDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKG 407
            :||          .:..::|:. .|:|..|:|.|.:.|....:|             |..|:.|.
Zfish   149 VDS----------SISSSAEVG-KCISRNGHPEPRIIWFKDDNP-------------LPEEKKKT 189

  Fly   408 EK------LDKDG---YKINSG-----AKSEARLPAVYRAHHNARILCVMEH--PTLKIRQNAS- 455
            ||      |.|:.   |.:.|.     .|::|:  :||.        |::|:  |..:|:|.:| 
Zfish   190 EKTYMIHFLVKEASGLYTLTSMLYMHLTKADAK--SVYH--------CIVEYTMPDNQIKQESSD 244

  Fly   456 -LLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNPPSTPRWQKDDGDTPVPQTGDGFLNF 519
             ..:.:||:......:....| |::||.:|.::|:.|.||  .|::....|:..:...| |.|..
Zfish   245 NFNISLQYSTENVFFKVKNEG-PIKEGDDVVMQCETDGNP--QPQFDFFKGEKLLEGLG-GTLKK 305

  Fly   520 TSIRREHSGWYKCTSRHLNFQYSS---IGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLE 581
            .||.||.||.|||.:  ::::..|   :...|::....:|:|.||:               |.|.
Zfish   306 KSITREDSGTYKCEA--MDYEADSKVQLHKTLNINVHYIDITVEPE---------------GPLV 353

  Fly   582 VQLGGAVTLQCPQGSLGC----WSHLDPISARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKCVGQ 642
            |..|..|.|||...:...    |:   ..|..|..        ||.|:.:.|...|.|:|.|||.
Zfish   354 VSKGDHVELQCKAKASEAHTLQWT---KDSKELSN--------TGVFAKESVTLADGGVYVCVGA 407

  Fly   643 SPTNKKKLEVLQSVTVSVKGAPTV--------------MALNATPVAYPGSPLHLNVEFCANPPA 693
            .| :...|:...::||:|||.|.:              :.||.:.:.:|..      :|...|..
Zfish   408 VP-SVPGLQKQVNITVNVKGQPEIDAPVKGLVDKEGGMVTLNCSALGHPAP------QFIWTPSG 465

  Fly   694 HAARWLHGDRVFT 706
            ..:..:.|:||.:
Zfish   466 KESVTVKGNRVIS 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17716NP_001286391.1 IG_like 244..332 CDD:214653 14/53 (26%)
Ig 254..323 CDD:143165 12/44 (27%)
Ig 359..452 CDD:299845 25/108 (23%)
Ig_3 477..536 CDD:290638 22/58 (38%)
IG_like 479..550 CDD:214653 23/73 (32%)
IG_like 578..660 CDD:214653 25/85 (29%)
bcamNP_001352817.1 V-set 31..131 CDD:311561 12/44 (27%)
Ig 138..234 CDD:325142 28/131 (21%)
Ig_3 267..320 CDD:316449 21/55 (38%)
Ig_2 351..422 CDD:316418 22/82 (27%)
Ig_3 428..499 CDD:316449 9/57 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5177
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto40408
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.