DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Tmem25

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001102998.1 Gene:Tmem25 / 689172 RGDID:1596132 Length:365 Species:Rattus norvegicus


Alignment Length:238 Identity:66/238 - (27%)
Similarity:96/238 - (40%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 VKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGA 421
            ::||......|...||:..|.|.|.      :|...||  |....|..:.|:..        ||.
  Rat    42 LRENEHHAFTCRVAGGSATPRLAWY------LDGQLQK--ATTSRLLSVGGDAF--------SGG 90

  Fly   422 KSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLRE--GIEV 484
            .|...:.| .|:.|  .:.|.::.|......|||::|:||:.|..|   ..|..|...:  |:.|
  Rat    91 TSTFTVTA-QRSQH--ELNCSLQDPGSGRPANASVILNVQFKPEIA---QVGAKYQEAQGPGLLV 149

  Fly   485 SLKCDVDSNPPSTPRWQKDDGDTPVPQTGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLS 549
            .|...|.:|||:...|...||  ||......||   .:..::..|  .|:..:..|..|:.:.||
  Rat   150 VLFALVRANPPANVTWIDQDG--PVTVNASDFL---VLDAQNYPW--LTNHTVQLQLRSLAHNLS 207

  Fly   550 VRFDSVDVTSEPDDQDVSVAAASHNPNKG----QLEVQLGGAV 588
            |      |.:    .||.|.:|| .|..|    ::||.|.|.|
  Rat   208 V------VAT----NDVGVTSAS-LPAPGLLATRIEVPLLGIV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 296..300 CDD:409353
Ig strand F 310..315 CDD:409353
Ig strand G 326..329 CDD:409353
Ig 359..452 CDD:472250 22/92 (24%)
Ig_3 478..533 CDD:464046 15/56 (27%)
IG_like 578..660 CDD:214653 6/15 (40%)
Tmem25NP_001102998.1 Ig 27..118 CDD:472250 22/94 (23%)
Ig strand B 48..52 CDD:409353 0/3 (0%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand E 91..94 CDD:409353 1/2 (50%)
Ig strand F 104..109 CDD:409353 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.