DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and ROBO2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_011532283.1 Gene:ROBO2 / 6092 HGNCID:10250 Length:1597 Species:Homo sapiens


Alignment Length:735 Identity:149/735 - (20%)
Similarity:249/735 - (33%) Gaps:197/735 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PRSTLHLAPEDMQPKPKEPVIIIDDVEEFDSGTSTSDLIARKSREEAEEEEDEGPLEPRVLP--- 229
            ||...|  |.|:.....||..:....|    |..|..:...|..|..|.::|:......:||   
Human    54 PRIVEH--PSDVIVSKGEPTTLNCKAE----GRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGS 112

  Fly   230 ---LRPVPPNPYEAEEMSVVYAEQH-----------SEIKLMCE------VDLDIA--------- 265
               ||.|.....:.:|.|.|...::           .|:.|:.:      .|:.:|         
Human   113 LFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILEC 177

  Fly   266 ---------TSMWYKNGQVVHAMDRTARVTDYRFIKEANGALTITNVMLEDDGKWQCEAENTRRY 321
                     |..|.|:  .|...|:..|::    |:  .|.|.|:|....|.|.:.|...|... 
Human   178 QPPRGHPEPTIYWKKD--KVRIDDKEERIS----IR--GGKLMISNTRKSDAGMYTCVGTNMVG- 233

  Fly   322 TENARPVKLVVLDRP---KPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTWEVL 383
            ..::.|.:|.|.:||   :.|...:             |.|...:...|..: |:|:||:.|   
Human   234 ERDSDPAELTVFERPTFLRRPINQV-------------VLEEEAVEFRCQVQ-GDPQPTVRW--- 281

  Fly   384 LSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTL 448
                     :|..|::     .:|....||.|.:.. .|:.:.....|        :|:.|:...
Human   282 ---------KKDDADL-----PRGRYDIKDDYTLRI-KKTMSTDEGTY--------MCIAENRVG 323

  Fly   449 KIRQNASLLLDVQ--YTPSFAISRTPGFGYPLREGIEVSLKCDVDSNPPSTPRWQKDDGDT---- 507
            |:..:|:|.:..:  ..|.|.:......   :.:|..|:..|:...||.....|||:....    
Human   324 KMEASATLTVRARPVAPPQFVVRPRDQI---VAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFP 385

  Fly   508 ----------PVPQTGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLS-VRFDSVDVTSE- 560
                      .|..|||  |..|:|:|..:|:|.|.:      .:..|..|: .:.:..||.:: 
Human   386 NQPQQPNSRCSVSPTGD--LTITNIQRSDAGYYICQA------LTVAGSILAKAQLEVTDVLTDR 442

  Fly   561 --------PDDQDVSVAAASHNPNKGQLEVQLGGAVTLQCPQGSLGCWSHLDP---ISARLRGLG 614
                    |.:|.::|                .|...|:|....       ||   ||....|..
Human   443 PPPIILQGPANQTLAV----------------DGTALLKCKATG-------DPLPVISWLKEGFT 484

  Fly   615 YGSSQP------TGQFSLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVTVSVKGAPTVMALNATP 673
            :....|      .|...:|::...|.|.|.||..|.:.:.....:..||.|  ||  .::.|...
Human   485 FPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTES--GA--TISKNYDL 545

  Fly   674 VAYPGSPLHLNV-EFCANPPAHAARWLHGDRVFTPGNQYGTTVLAYAVKDLPTPFCKEARLTYVS 737
            ...||.|....| :...|  :....|..|.....|.:.|.....:.:|.:.........:.|..:
Human   546 SDLPGPPSKPQVTDVTKN--SVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYT 608

  Fly   738 MHERVPRTFY-FIV--------STPGGVAEAIFNVNFTK-----RHRQLSNSIDDDEEEELNRPE 788
            :....|.|.| |:|        |.|..:::.:...:.:.     .|||:...:.|    .|.|  
Human   609 VRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGD----VLVR-- 667

  Fly   789 QIHFPVFNGSPADGRGWWAV 808
             :|.||.. :|...:..|.|
Human   668 -LHNPVVL-TPTTVQVTWTV 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 23/122 (19%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 2/3 (67%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 18/92 (20%)
Ig_3 478..533 CDD:464046 18/68 (26%)
IG_like 578..660 CDD:214653 19/90 (21%)
ROBO2XP_011532283.1 IgC_1_Robo 54..152 CDD:409490 23/103 (22%)
Ig strand A 54..58 CDD:409490 2/3 (67%)
Ig strand A' 61..66 CDD:409490 1/4 (25%)
Ig strand B 70..78 CDD:409490 1/7 (14%)
Ig strand C 84..89 CDD:409490 0/4 (0%)
Ig strand C' 92..94 CDD:409490 1/1 (100%)
Ig strand D 105..108 CDD:409490 0/2 (0%)
Ig strand E 111..117 CDD:409490 0/5 (0%)
Ig strand F 129..137 CDD:409490 2/7 (29%)
Ig strand G 140..152 CDD:409490 1/11 (9%)
Ig 159..244 CDD:472250 19/93 (20%)
Ig strand B 173..177 CDD:409353 0/3 (0%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 209..213 CDD:409353 2/3 (67%)
Ig strand F 223..228 CDD:409353 1/4 (25%)
Ig strand G 237..240 CDD:409353 0/2 (0%)
Ig 251..333 CDD:472250 22/121 (18%)
Ig strand B 265..269 CDD:409353 0/3 (0%)
Ig strand C 278..282 CDD:409353 2/15 (13%)
Ig strand E 299..303 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/12 (17%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
IgI_4_Robo 342..439 CDD:409391 23/107 (21%)
Ig strand A 342..346 CDD:409391 1/3 (33%)
Ig strand A' 348..352 CDD:409391 0/6 (0%)
Ig strand B 358..366 CDD:409391 2/7 (29%)
Ig strand C 369..376 CDD:409391 1/6 (17%)
Ig strand C' 378..381 CDD:409391 0/2 (0%)
Ig strand D 394..399 CDD:409391 1/4 (25%)
Ig strand E 401..408 CDD:409391 4/8 (50%)
Ig strand F 414..423 CDD:409391 3/14 (21%)
Ig strand G 425..436 CDD:409391 2/10 (20%)
IgI_5_Robo 446..532 CDD:409544 20/108 (19%)
Ig strand A 446..449 CDD:409544 0/2 (0%)
Ig strand A' 453..456 CDD:409544 1/2 (50%)
Ig strand B 462..469 CDD:409544 2/6 (33%)
Ig strand C 475..480 CDD:409544 2/4 (50%)
Ig strand C' 482..484 CDD:409544 1/1 (100%)
Ig strand D 491..495 CDD:409544 0/3 (0%)
Ig strand E 498..503 CDD:409544 1/4 (25%)
FN3 <510..882 CDD:442628 41/190 (22%)
Ig strand F 511..519 CDD:409544 4/7 (57%)
Ig strand G 522..532 CDD:409544 0/9 (0%)
FN3 549..642 CDD:238020 18/94 (19%)

Return to query results.
Submit another query.