DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Nectin1

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_067399.2 Gene:Nectin1 / 58235 MGIID:1926483 Length:515 Species:Mus musculus


Alignment Length:311 Identity:68/311 - (21%)
Similarity:115/311 - (36%) Gaps:74/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 NGALTITNVMLEDDGKWQCE--------AENTRRYTENARPVKLVVLDRPKPPYLLIDSRRLDAS 351
            :|.:.::.:.|||:|.:.||        .|:....|..|:|...:...|     .::.:|:    
Mouse   106 DGTIRLSGLELEDEGMYICEFATFPTGNRESQLNLTVMAKPTNWIEGTR-----AVLRARK---- 161

  Fly   352 NLFVPVKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYK 416
                 .:::..|...|.|..|.|...::||..|         |..||..|:....|.......|:
Mouse   162 -----GQDDKVLVATCTSANGKPPSAVSWETRL---------KGEAEYQEIRNPNGTVTVISRYR 212

  Fly   417 INSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLREG 481
            :         :|:  |..|...:.|::.:...:.|:  ||.|:|||.|...|....|..|..|  
Mouse   213 L---------VPS--REAHRQSLACIVNYHLDRFRE--SLTLNVQYEPEVTIEGFDGNWYLQR-- 262

  Fly   482 IEVSLKCDVDSNPPSTP-RWQKDDGDTPVPQTGDGFLNFTSIRREHSGWYKCTSRHLNFQ----Y 541
            .:|.|.|..|:|||:|. .|...:|..|                  .| .:..:|.|.|:    |
Mouse   263 TDVKLTCKADANPPATEYHWTTLNGSLP------------------KG-VEAQNRTLFFRGPITY 308

  Fly   542 SSIGYYLSVRFDSVDVTSEPDDQDVS----VAAASHNPNKGQLEVQLGGAV 588
            |..|.|:....:.:...|...:.:::    .....|....||:...:.|.|
Mouse   309 SLAGTYICEATNPIGTRSGQVEVNITEFPYTPTPEHGRRAGQMPTAIIGGV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 11/44 (25%)
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 2/12 (17%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 18/92 (20%)
Ig_3 478..533 CDD:464046 13/55 (24%)
IG_like 578..660 CDD:214653 4/11 (36%)
Nectin1NP_067399.2 IgV_1_Nectin-1_like 31..143 CDD:409469 9/36 (25%)
FR1 31..54 CDD:409469
Ig strand A 31..35 CDD:409469
Ig strand A' 37..41 CDD:409469
Ig strand B 46..54 CDD:409469
CDR1 55..62 CDD:409469
FR2 63..69 CDD:409469
Ig strand C 64..69 CDD:409469
CDR2 70..89 CDD:409469
Ig strand C' 79..84 CDD:409469
Ig strand C' 86..90 CDD:409469
FR3 90..128 CDD:409469 7/21 (33%)
Ig strand D 97..101 CDD:409469
Ig strand E 106..113 CDD:409469 1/6 (17%)
Ig strand F 120..128 CDD:409469 3/7 (43%)
CDR3 129..132 CDD:409469 0/2 (0%)
Ig strand G 132..142 CDD:409469 1/9 (11%)
FR4 133..143 CDD:409469 2/9 (22%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 25/132 (19%)
Ig strand A 146..152 CDD:143298 1/5 (20%)
Ig strand B 168..175 CDD:143298 2/6 (33%)
Ig strand C 180..186 CDD:143298 0/5 (0%)
Ig strand C' 188..190 CDD:143298 1/10 (10%)
Ig strand D 191..199 CDD:143298 3/7 (43%)
Ig strand E 205..213 CDD:143298 1/7 (14%)
Ig strand F 223..230 CDD:143298 1/6 (17%)
Ig strand G 234..240 CDD:143298 2/7 (29%)
Ig 247..333 CDD:472250 25/106 (24%)
Ig strand B 265..269 CDD:409524 2/3 (67%)
Ig strand C 279..283 CDD:409524 0/3 (0%)
Interaction with FGFR. /evidence=ECO:0000269|PubMed:22955284 282..299 4/35 (11%)
Ig strand E 298..302 CDD:409524 2/3 (67%)
Ig strand F 313..318 CDD:409524 1/4 (25%)
Ig strand G 330..333 CDD:409524 0/2 (0%)
TM_EGFR-like 353..382 CDD:213052 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..486
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.