DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and NECTIN2

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001036189.1 Gene:NECTIN2 / 5819 HGNCID:9707 Length:538 Species:Homo sapiens


Alignment Length:642 Identity:115/642 - (17%)
Similarity:200/642 - (31%) Gaps:219/642 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LIARKSREEAEEEEDEGPLEPRVLPLRPVPPNPYEAEEMSVVYAEQHSEIKLMCEVDLDIATSMW 269
            |:..:..:.....::.....|::.|..| .|.| .:|.:|.|.|:|                   
Human    67 LVTWQRPDAPANHQNVAAFHPKMGPSFP-SPKP-GSERLSFVSAKQ------------------- 110

  Fly   270 YKNGQVVHAMDRTARVTDYRFIKEANGALTITNVMLEDDGKWQCE-----AENTRRYTENARPVK 329
             ..||     |..|.:.|        ..|.:..:.:||:|.:.||     ..:.|..|      .
Human   111 -STGQ-----DTEAELQD--------ATLALHGLTVEDEGNYTCEFATFPKGSVRGMT------W 155

  Fly   330 LVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQK 394
            |.|:.:||        .:.:|..  |...::......|:|:.|.|...::|   || .:|..|::
Human   156 LRVIAKPK--------NQAEAQK--VTFSQDPTTVALCISKEGRPPARISW---LS-SLDWEAKE 206

  Fly   395 VSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLD 459
            ....    ..:.|.......:.:....:::           ...:.|.:||.:.:......:.|.
Human   207 TQVS----GTLAGTVTVTSRFTLVPSGRAD-----------GVTVTCKVEHESFEEPALIPVTLS 256

  Fly   460 VQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNP-PSTPRWQKDDGDTPVPQTGDGF-LNFTSI 522
            |:|.|..:||......|..|  .:.:|.|||.||| |:...|....|..|......|. |...::
Human   257 VRYPPEVSISGYDDNWYLGR--TDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAV 319

  Fly   523 RREHSGWYKCTSRHLNFQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLEVQLGGA 587
            ....:..:.||..      :::|...:             :|.:.|....:....|.....:||.
Human   320 DSLFNTTFVCTVT------NAVGMGRA-------------EQVIFVRETPNTAGAGATGGIIGGI 365

  Fly   588 V-----TLQCPQGSLGCWSHLDPISARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKCVGQSPTNK 647
            :     |.....|.|.|...              ..:.|.|.:.:|...:....||    .||.|
Human   366 IAAIIATAVAATGILICRQQ--------------RKEQTLQGAEEDEDLEGPPSYK----PPTPK 412

  Fly   648 KKLEVLQSVTVSVKGAPTVMALNATPVAYPGSPLHLNVEFCANPPAHAARWLHGDRVFTPGNQYG 712
            .|||..:..:                                             ::||.|    
Human   413 AKLEAQEMPS---------------------------------------------QLFTLG---- 428

  Fly   713 TTVLAYAVKDLPTPF------CKEARLTYVSMHERVPRTFYFIVST---------PGGVA----- 757
                |.....|.||:      |.|         :.:||  |..:.|         ||..:     
Human   429 ----ASEHSPLKTPYFDAGASCTE---------QEMPR--YHELPTLEERSGPLHPGATSLGSPI 478

  Fly   758 ------EAIFNVNFTKRHRQLSNSIDDDEEEELNRPEQIHFPVFNGSPAD---GRGW 805
                  .|:.:|:.     .|.:...::|||.|::...|:..:...||:|   |:|:
Human   479 PVPPGPPAVEDVSL-----DLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGF 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 18/92 (20%)
Ig strand B 254..258 CDD:409353 0/3 (0%)
Ig strand C 267..271 CDD:409353 0/3 (0%)
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 2/9 (22%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 13/92 (14%)
Ig_3 478..533 CDD:464046 14/56 (25%)
IG_like 578..660 CDD:214653 18/86 (21%)
NECTIN2NP_001036189.1 IgV_1_Nectin-2_NecL-5_like_CD112_CD155 34..158 CDD:409581 25/131 (19%)
FR1 34..57 CDD:409581
Ig strand A 34..38 CDD:409581
Ig strand A' 40..44 CDD:409581
Ig strand B 49..57 CDD:409581
CDR1 58..65 CDD:409581
FR2 66..72 CDD:409581 1/4 (25%)
Ig strand C 67..72 CDD:409581 1/4 (25%)
CDR2 73..93 CDD:409581 2/19 (11%)
Ig strand C' 83..88 CDD:409581 0/4 (0%)
Ig strand C' 90..93 CDD:409581 1/2 (50%)
FR3 94..144 CDD:409581 19/84 (23%)
Ig strand D 102..108 CDD:409581 2/5 (40%)
Ig strand E 122..129 CDD:409581 2/14 (14%)
Ig strand F 136..144 CDD:409581 3/7 (43%)
CDR3 145..148 CDD:409581 0/2 (0%)
Ig strand G 148..158 CDD:409581 3/15 (20%)
FR4 149..158 CDD:409581 3/14 (21%)
IgC1_2_Nectin-2_Necl-5_like 162..258 CDD:409500 18/124 (15%)
Ig strand A 162..168 CDD:409500 2/13 (15%)
Ig strand B 179..186 CDD:409500 1/6 (17%)
Ig strand C 191..197 CDD:409500 1/8 (13%)
Ig strand C' 199..201 CDD:409500 0/1 (0%)
Ig strand D 204..212 CDD:409500 1/11 (9%)
Ig strand E 217..225 CDD:409500 0/7 (0%)
Ig strand F 235..242 CDD:409500 1/6 (17%)
Ig strand G 248..254 CDD:409500 0/5 (0%)
Ig3_Nectin-5_like 261..346 CDD:409524 22/105 (21%)
Ig strand A 261..267 CDD:409524 2/5 (40%)
Ig strand B 279..283 CDD:409524 1/3 (33%)
Ig strand C 293..298 CDD:409524 1/4 (25%)
Ig strand C' 300..303 CDD:409524 1/2 (50%)
Ig strand D 306..311 CDD:409524 0/4 (0%)
Ig strand E 312..318 CDD:409524 1/5 (20%)
Ig strand F 323..333 CDD:409524 2/15 (13%)
Ig strand G 336..346 CDD:409524 2/22 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..414 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..489 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.