DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and PVR

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_006496.4 Gene:PVR / 5817 HGNCID:9705 Length:417 Species:Homo sapiens


Alignment Length:231 Identity:51/231 - (22%)
Similarity:85/231 - (36%) Gaps:65/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 NGALTITNVMLEDDGKWQCEAENTRRYTENARPVK--LVVLDRPKPPYLLIDSRRLDASNLFVPV 357
            |.:|.:..:.:||:|.:.|....   :.:.:|.|.  |.||.:|:.   ..:.:::..:...||:
Human   105 NASLRMFGLRVEDEGNYTCLFVT---FPQGSRSVDIWLRVLAKPQN---TAEVQKVQLTGEPVPM 163

  Fly   358 KENSELNLACVSEGGNPRPTLTWEVLLS--PGVDRHAQKVSAEV--------LELEEIKGEKLDK 412
            ..       |||.||.|...:||...|.  |...:....:|..|        :...::.|:    
Human   164 AR-------CVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGK---- 217

  Fly   413 DGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYP 477
                                     .:.|.:||.:.:..|..::.|.|.|.|..:||     ||.
Human   218 -------------------------NVTCKVEHESFEKPQLLTVNLTVYYPPEVSIS-----GYD 252

  Fly   478 ----LREGIEVSLKCDVDSNP-PSTPRWQKDDGDTP 508
                |.:. |.:|.||..||| |:...|....|..|
Human   253 NNWYLGQN-EATLTCDARSNPEPTGYNWSTTMGPLP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 9/38 (24%)
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 296..300 CDD:409353 1/3 (33%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 1/2 (50%)
Ig 359..452 CDD:472250 16/102 (16%)
Ig_3 478..533 CDD:464046 12/32 (38%)
IG_like 578..660 CDD:214653
PVRNP_006496.4 IgV_1_Nectin-2_NecL-5_like_CD112_CD155 29..141 CDD:409581 9/38 (24%)
FR1 29..52 CDD:409581
Ig strand A 29..33 CDD:409581
Ig strand A' 35..39 CDD:409581
Ig strand B 44..52 CDD:409581
CDR1 53..61 CDD:409581
FR2 62..68 CDD:409581
Ig strand C 63..68 CDD:409581
CDR2 69..86 CDD:409581
Ig strand C' 76..81 CDD:409581
Ig strand C' 83..86 CDD:409581
FR3 87..127 CDD:409581 6/21 (29%)
Ig strand D 91..97 CDD:409581
Ig strand E 105..112 CDD:409581 2/6 (33%)
Ig strand F 119..127 CDD:409581 2/7 (29%)
CDR3 128..131 CDD:409581 0/2 (0%)
Ig strand G 131..141 CDD:409581 3/9 (33%)
FR4 132..141 CDD:409581 3/8 (38%)
IgC1_2_Nectin-2_Necl-5_like 145..241 CDD:409500 21/134 (16%)
Ig strand A 145..151 CDD:409500 1/8 (13%)
Ig strand B 162..169 CDD:409500 3/13 (23%)
Ig strand C 174..180 CDD:409500 1/5 (20%)
Ig strand C' 182..184 CDD:409500 0/1 (0%)
Ig strand D 187..195 CDD:409500 1/7 (14%)
Ig strand E 200..208 CDD:409500 1/7 (14%)
Ig strand F 218..225 CDD:409500 1/6 (17%)
Ig strand G 231..237 CDD:409500 1/5 (20%)
Ig3_Nectin-5_like 244..329 CDD:409524 17/50 (34%)
Ig strand A 244..250 CDD:409524 3/10 (30%)
Ig strand B 262..266 CDD:409524 1/3 (33%)
Ig strand C 276..281 CDD:409524 1/4 (25%)
Ig strand C' 283..286 CDD:409524 1/2 (50%)
Ig strand D 289..294 CDD:409524
Ig strand E 295..301 CDD:409524
Ig strand F 306..316 CDD:409524
Ig strand G 319..329 CDD:409524
DYNLT1 binding 368..372
ITIM motif 396..401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.