DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and DSCAML1

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens


Alignment Length:750 Identity:145/750 - (19%)
Similarity:237/750 - (31%) Gaps:291/750 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IIIDDVEEFDSGTSTSDLIARKSREEAEEEEDEG----------PLEPRVLPLRPVPPNPYEAEE 242
            :.|.||::.|: .||...|. |.:...|..:..|          ..:|..|      |:|  ||.
Human   182 LYISDVQKEDA-LSTYRCIT-KHKYSGETRQSNGARLSVTGLARAADPLCL------PDP--AES 236

  Fly   243 MSVVYAEQHSE-------IKLMCEVD-LDIATSMWYKNGQVVHAMDRTARVTDYRFIKEANGALT 299
            :..:....||:       ::|.|... ..|....|.|:|:.:.|        |.|:.|...| ||
Human   237 IPTILDGFHSQEVWAGHTVELPCTASGYPIPAIRWLKDGRPLPA--------DSRWTKRITG-LT 292

  Fly   300 ITNVMLEDDGKWQCEAENTRRYTENARPVKLVVLDRPKPPYLLIDSRRLDASNLFVPVKENSELN 364
            |:::..||.|.:.||..||....| |..: |:|:|   |.::.:..::|...       ..|.:.
Human   293 ISDLRTEDSGTYICEVTNTFGSAE-ATGI-LMVID---PLHVTLTPKKLKTG-------IGSTVI 345

  Fly   365 LACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPA 429
            |:|... |:|..|:.|.        |:.:.|..:  |...|:|  |..:...|.|..||      
Human   346 LSCALT-GSPEFTIRWY--------RNTELVLPD--EAISIRG--LSNETLLITSAQKS------ 391

  Fly   430 VYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSLKCDVDSNP 494
                 |:....|.........:..|.:.|: ..||....|.:.....|   |.:.||.|.....|
Human   392 -----HSGAYQCFATRKAQTAQDFAIIALE-DGTPRIVSSFSEKVVNP---GEQFSLMCAAKGAP 447

  Fly   495 PSTPRWQKDDGDTPVPQTG----------DG----FLNFTSIRREHSGWYKCTSRHL--NFQYSS 543
            |.|..|..|  |.|:.:.|          ||    .:|.|..:....|.|:||:|:|  :.:|.:
Human   448 PPTVTWALD--DEPIVRDGSHRTNQYTMSDGTTISHMNVTGPQIRDGGVYRCTARNLVGSAEYQA 510

  Fly   544 ------------------------------IGY-YLSVR----------------FDS-----VD 556
                                          ||| |.|::                |::     .|
Human   511 RINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKDALLLPDNHRQVVFENGTLKLTD 575

  Fly   557 VTSEPDDQD----------VSVAAASH---------NP------------------NKGQLEVQL 584
            |....|:.:          :|::.:.|         .|                  :.|.:.:::
Human   576 VQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRI 640

  Fly   585 -----------GGAVTLQCPQ-------------------------------------------- 594
                       |..||::..:                                            
Human   641 TWRKDGQVIISGSGVTIESKEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPRFV 705

  Fly   595 -------------GSLGC-----------WSHLD-----------PISARLRGLGYGSSQPTGQF 624
                         |.|.|           |.|..           |::.|::.|      |....
Human   706 VQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQIL------PNSSL 764

  Fly   625 SLKDVMYQDAGMYKCVGQSPTNKKKLEVLQSVTVSVKGAPTVMALNATPVAYPGSPLHLNVEFCA 689
            .::.|:.:|.|.|.|   ..:|....::.:|:.::||....:.:...|.:|..|....||.....
Human   765 LIRHVLEEDIGYYLC---QASNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCTARG 826

  Fly   690 NPPAHAARWLHGDRVFTPGNQYGTTVLAYAV--KD 722
            ..|. ..||..||.|..|..     |:.||:  ||
Human   827 ERPI-IIRWEKGDTVIDPDR-----VMRYAIATKD 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 26/95 (27%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 2/3 (67%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 19/92 (21%)
Ig_3 478..533 CDD:464046 18/68 (26%)
IG_like 578..660 CDD:214653 20/171 (12%)
DSCAML1XP_011541219.1 Ig 27..122 CDD:472250
Ig strand B 43..47 CDD:409353
Ig strand C 56..60 CDD:409353
Ig strand E 80..84 CDD:409353
Ig strand F 100..105 CDD:409353
Ig strand G 113..117 CDD:409353
Ig 130..218 CDD:472250 10/37 (27%)
Ig strand B 142..146 CDD:409353
Ig strand C 158..162 CDD:409353
Ig strand E 180..184 CDD:409353 0/1 (0%)
Ig strand F 195..200 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
I-set 245..323 CDD:400151 26/88 (30%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand F 303..308 CDD:409353 1/4 (25%)
Ig strand G 317..320 CDD:409353 1/2 (50%)
Ig 326..415 CDD:472250 22/119 (18%)
Ig strand B 344..348 CDD:409353 1/3 (33%)
Ig strand C 357..361 CDD:409353 1/3 (33%)
Ig strand E 381..385 CDD:409353 0/3 (0%)
Ig strand F 395..400 CDD:409353 1/4 (25%)
Ig strand G 408..411 CDD:409353 0/2 (0%)
Ig 419..514 CDD:472250 27/99 (27%)
Ig strand B 437..441 CDD:409353 2/3 (67%)
Ig strand C 450..454 CDD:409353 1/3 (33%)
Ig strand E 480..484 CDD:409353 0/3 (0%)
Ig strand F 494..499 CDD:409353 2/4 (50%)
Ig strand G 507..510 CDD:409353 1/2 (50%)
Ig 517..605 CDD:472250 11/87 (13%)
Ig strand B 534..538 CDD:409353 0/3 (0%)
Ig strand C 547..551 CDD:409353 1/3 (33%)
Ig strand E 569..573 CDD:409353 0/3 (0%)
Ig strand F 584..589 CDD:409353 0/4 (0%)
Ig strand G 598..601 CDD:409353 0/2 (0%)
Ig 608..698 CDD:472250 5/89 (6%)
Ig strand B 625..629 CDD:409353 0/3 (0%)
Ig strand C 639..643 CDD:409353 0/3 (0%)
Ig strand E 664..668 CDD:409353 0/3 (0%)
Ig strand F 678..683 CDD:409353 0/4 (0%)
Ig strand G 691..694 CDD:409353 0/2 (0%)
Ig_DSCAM 701..797 CDD:409397 16/104 (15%)
putative Ig strand A 701..705 CDD:409397 0/3 (0%)
putative Ig strand A' 710..714 CDD:409397 0/3 (0%)
putative Ig strand B 716..726 CDD:409397 3/9 (33%)
putative Ig strand C 732..738 CDD:409397 1/5 (20%)
putative Ig strand C' 745..748 CDD:409397 0/2 (0%)
putative Ig strand D 757..760 CDD:409397 1/8 (13%)
putative Ig strand E 762..768 CDD:409397 0/5 (0%)
putative Ig strand F 775..783 CDD:409397 3/10 (30%)
putative Ig strand G 788..797 CDD:409397 1/8 (13%)
Ig_DSCAM 798..898 CDD:409398 17/63 (27%)
putative Ig strand A 798..801 CDD:409398 1/2 (50%)
putative Ig strand A' 809..813 CDD:409398 1/3 (33%)
putative Ig strand B 816..823 CDD:409398 2/6 (33%)
putative Ig strand C 831..837 CDD:409398 2/5 (40%)
putative Ig strand C' 847..850 CDD:409398 0/2 (0%)
putative Ig strand D 856..860 CDD:409398 144/749 (19%)
putative Ig strand E 862..868 CDD:409398
putative Ig strand F 875..883 CDD:409398
putative Ig strand G 886..896 CDD:409398
FN3 <895..1208 CDD:442628
fn3 <1223..1289 CDD:394996
Ig_3 1303..1379 CDD:464046
FN3 1396..1486 CDD:238020
FN3 1500..1572 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.