DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tei and Cadm1

DIOPT Version :10

Sequence 1:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001297770.1 Gene:Cadm1 / 54725 MGIID:1889272 Length:474 Species:Mus musculus


Alignment Length:423 Identity:84/423 - (19%)
Similarity:153/423 - (36%) Gaps:133/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 EEMSVVYAEQHSEIKLMCEVDL--DIATSMWYKNGQVVHAMD-RTARVTDYRFIKEANGAL--TI 300
            ::::|:..|..:   :.|:|:.  |....:...|.|.::..| |..:.:.::.:..::..|  ::
Mouse    53 KDVTVIEGEVAT---ISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSL 114

  Fly   301 TNVMLEDDGKWQCEAENTRRYTENARPVKLVVLDRPKPPY----LLIDSRRLDASNLFVPVK--- 358
            |||.:.|:|::.|:.     ||           |.|:..|    :|:..|     ||.:.::   
Mouse   115 TNVSISDEGRYFCQL-----YT-----------DPPQESYTTITVLVPPR-----NLMIDIQKDT 158

  Fly   359 --ENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDK--------- 412
              |..|:.:.|.:....|..|:.|                        .||.|..|         
Mouse   159 AVEGEEIEVNCTAMASKPATTIRW------------------------FKGNKELKGKSEVEEWS 199

  Fly   413 DGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYP 477
            |.|.:.|     ..:..|::......::|.:|||.:.........|:|||.|...|..|    ||
Mouse   200 DMYTVTS-----QLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT----YP 255

  Fly   478 L----REGIEVSLKCDVDSNP-PSTPRWQKDDGDTPVPQTGDG---FLNFTSIRREHSGWYKCTS 534
            |    |||....|.|:....| |....|.:.|.:.|......|   |:|  ::.:..:|.|:|.:
Mouse   256 LQGLTREGDAFELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFIN--NLNKTDNGTYRCEA 318

  Fly   535 RHL----NFQYSSIGY----------------------YLSVRFDSVDVTSEP------------ 561
            .::    :..|....|                      .|::..|:. .|:||            
Mouse   319 SNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITDTT-ATTEPAVHGLTQLPNSA 382

  Fly   562 ---DDQDVSVAAASHNPNKGQLE-VQLGGAVTL 590
               |.:|:|.:.|......|.:: ..:||.|.:
Mouse   383 EELDSEDLSDSRAGEEGTIGAVDHAVIGGVVAV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teiNP_523731.2 IG_like 244..332 CDD:214653 18/92 (20%)
Ig strand B 254..258 CDD:409353 0/3 (0%)
Ig strand C 267..271 CDD:409353 0/3 (0%)
Ig strand E 296..300 CDD:409353 1/5 (20%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 18/101 (18%)
Ig_3 478..533 CDD:464046 16/62 (26%)
IG_like 578..660 CDD:214653 4/14 (29%)
Cadm1NP_001297770.1 IgV_1_Necl-2 50..143 CDD:409465 21/108 (19%)
FR1 50..68 CDD:409465 2/17 (12%)
Ig strand A 50..52 CDD:409465
Ig strand A' 53..59 CDD:409465 1/5 (20%)
Ig strand B 61..69 CDD:409465 2/10 (20%)
CDR1 69..74 CDD:409465 1/4 (25%)
FR2 75..82 CDD:409465 0/6 (0%)
Ig strand C 75..81 CDD:409465 0/5 (0%)
CDR2 83..94 CDD:409465 3/10 (30%)
Ig strand C' 85..89 CDD:409465 1/3 (33%)
Ig strand C' 91..94 CDD:409465 1/2 (50%)
FR3 95..130 CDD:409465 7/39 (18%)
Ig strand D 99..106 CDD:409465 0/6 (0%)
Ig strand E 109..115 CDD:409465 1/5 (20%)
Ig strand F 122..130 CDD:409465 2/12 (17%)
CDR3 131..134 CDD:409465 2/13 (15%)
Ig strand G 134..143 CDD:409465 2/8 (25%)
FR4 136..143 CDD:409465 1/6 (17%)
IgI_2_Necl-2 144..242 CDD:409466 23/131 (18%)
Ig strand A 144..147 CDD:409466 1/2 (50%)
Ig strand A' 150..154 CDD:409466 1/3 (33%)
Ig strand B 163..173 CDD:409466 2/9 (22%)
Ig strand C 176..185 CDD:409466 3/32 (9%)
Ig strand C' 186..189 CDD:409466 1/2 (50%)
Ig strand D 191..198 CDD:409466 0/6 (0%)
Ig strand E 201..211 CDD:409466 2/14 (14%)
Ig strand F 219..227 CDD:409466 1/7 (14%)
Ig strand G 234..241 CDD:409466 0/6 (0%)
IG_like 255..333 CDD:214653 19/79 (24%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..284 CDD:409353 0/4 (0%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
4.1m 427..445 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.